Query         gi|254781128|ref|YP_003065541.1| hypothetical protein CLIBASIA_05150 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 225
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed Jun  1 11:31:50 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781128.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1qjpa_ f.4.1.1 (A:) Outer mem  66.0    0.39 2.8E-05   24.8  -0.9   51  175-225   120-170 (171)
  2 d1qj8a_ f.4.1.1 (A:) Outer mem  53.2     2.3 0.00017   20.2   1.2   73  138-225    76-148 (148)
  3 d1p4ta_ f.4.1.1 (A:) Outer mem  20.0      26  0.0019   14.0   3.4   48  176-225   108-155 (155)
  4 d1ywua1 b.45.2.1 (A:1-125) Hyp  16.0      31  0.0022   13.5   1.6   26   62-87     22-47  (125)
  5 d2jera1 d.126.1.6 (A:2-365) Ag  14.4      35  0.0025   13.2   1.7   54   63-118   140-216 (364)
  6 d1pwaa_ b.42.1.1 (A:) Fibrobla  14.1      32  0.0024   13.4   1.3   44   97-152    12-55  (136)
  7 d2gova1 d.60.1.4 (A:7-190) Hem  12.9      38  0.0028   13.0   1.4   19  190-208   154-172 (184)
  8 d1wp9a2 c.37.1.19 (A:201-486)   12.5      29  0.0021   13.6   0.8   45  166-211   208-253 (286)
  9 d2i4ra1 c.149.1.1 (A:4-79) V-t  10.8      29  0.0021   13.6   0.3   32  140-171     9-40  (76)
 10 d1dfca4 b.42.5.1 (A:1383-1493)   9.9      35  0.0025   13.2   0.4   30   78-109    46-75  (111)

No 1  
>d1qjpa_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]}
Probab=66.03  E-value=0.39  Score=24.83  Aligned_cols=51  Identities=22%  Similarity=0.417  Sum_probs=35.5

Q ss_pred             HHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             776503326777775300353358896168765455543067000057849
Q gi|254781128|r  175 DKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       175 dkvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      .-.+|+|++-++..-+++|.||||..-.+.......-.+-..++.|+..||
T Consensus       120 ~~~~G~G~~y~i~~~~~l~~ey~~~~~~~~~~~~~~~~~~~~~~~G~~Y~F  170 (171)
T d1qjpa_         120 SPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF  170 (171)
T ss_dssp             EEEEEEEEEEEEETTEEEEEEEEEEC--------------CEEEEEEEEEC
T ss_pred             CEEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             567982799992799799999999962586555454322448999999988


No 2  
>d1qj8a_ f.4.1.1 (A:) Outer membrane protein X (OMPX) {Escherichia coli [TaxId: 562]}
Probab=53.16  E-value=2.3  Score=20.23  Aligned_cols=73  Identities=21%  Similarity=0.227  Sum_probs=42.7

Q ss_pred             EEEEEEECCHHHHHEEECCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCC
Q ss_conf             00113325232100011022202578899886410067765033267777753003533588961687654555430670
Q gi|254781128|r  138 NTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDF  217 (225)
Q Consensus       138 ntliygfggarirnimsvesadtakstirnivangfldkvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdf  217 (225)
                      +.++|+-.|.-..+.. .+..++.+.      ..--..-..|+|+|-.+..-+++|.||+|.---       ++ +-..|
T Consensus        76 ~~~~Y~~~G~a~~~~~-~~~~~~~~~------~~~~~g~~~G~Gvey~l~~n~~~~~eY~~~~~~-------~~-d~~~~  140 (148)
T d1qj8a_          76 WASIYGVVGVGYGKFQ-TTEYPTYKN------DTSDYGFSYGAGLQFNPMENVALDFSYEQSRIR-------SV-DVGTW  140 (148)
T ss_dssp             TEEEEEEEEEEEEEEE-EEETTTEEE------EEEEEEEEEEEEEEECSSTTEEEEEEEEEEEET-------TE-EEEEE
T ss_pred             CEEEEEEEEEEEEEEE-ECCCCCCCC------CCCCCCEEEEEEEEEEECCCEEEEEEEEEEECC-------CC-EEEEE
T ss_conf             4549898677899998-413787655------645444469621799806887999999997479-------94-33069


Q ss_pred             CEEEEEEC
Q ss_conf             00057849
Q gi|254781128|r  218 TAGVVLRF  225 (225)
Q Consensus       218 tagvvlrf  225 (225)
                      +.|+--||
T Consensus       141 ~~Gv~YrF  148 (148)
T d1qj8a_         141 IAGVGYRF  148 (148)
T ss_dssp             EEEEEEEC
T ss_pred             EEEEEEEC
T ss_conf             99989889


No 3  
>d1p4ta_ f.4.1.1 (A:) Outer membrane protein NspA {Neisseria meningitidis [TaxId: 487]}
Probab=19.96  E-value=26  Score=13.99  Aligned_cols=48  Identities=21%  Similarity=0.346  Sum_probs=30.5

Q ss_pred             HHHHCCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHCCCCCEEEEEEC
Q ss_conf             76503326777775300353358896168765455543067000057849
Q gi|254781128|r  176 KVIGVGIEKKLASMLSIRGEYRYVACYDQPWDVSKWREKGDFTAGVVLRF  225 (225)
Q Consensus       176 kvigvgiekklasmlsirgeyryvacydqpwdvskwrekgdftagvvlrf  225 (225)
                      -.+|+|++-++..-++++.||||.---+.  +....-.-..++.|+--||
T Consensus       108 ~~~g~G~~y~lt~n~~~~~eyry~~~~~~--~~~~~~~~~~~~~Gl~Y~F  155 (155)
T d1p4ta_         108 LGVLTGVSYAVTPNVDLDAGYRYNYIGKV--NTVKNVRSGELSAGVRVKF  155 (155)
T ss_dssp             EEEEEEEEEEEETTEEEEEEEEEEEEEEE--TTEEEEEEEEEEEEEEEEC
T ss_pred             EEEEEEEEEEECCCEEEEEEEEEEECCCC--CCCCCCCEEEEEEEEEEEC
T ss_conf             58998999993599899999999975687--6675311049999999989


No 4  
>d1ywua1 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]}
Probab=16.01  E-value=31  Score=13.52  Aligned_cols=26  Identities=23%  Similarity=0.369  Sum_probs=19.4

Q ss_pred             HHHCCCCCCEEEEEEEECCEEEEECC
Q ss_conf             21124448615512332324766317
Q gi|254781128|r   62 FSKIDHQSPVRLQNLSLNGVSIGLDG   87 (225)
Q Consensus        62 fskidhqspvrlqnlslngvsigldg   87 (225)
                      .+.-++.-++++.|+|++|+.|.++.
T Consensus        22 l~~~~~~~~~~~~DiS~~G~~i~~~~   47 (125)
T d1ywua1          22 ILQGERRWEVLLHDVSLHGILVGQPQ   47 (125)
T ss_dssp             EEETTEEEEEEEEEECSSEEEEECSS
T ss_pred             EEECCEEEEEEEEEECCCCEEEECCC
T ss_conf             99999999999998217848997488


No 5  
>d2jera1 d.126.1.6 (A:2-365) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]}
Probab=14.43  E-value=35  Score=13.18  Aligned_cols=54  Identities=31%  Similarity=0.455  Sum_probs=33.9

Q ss_pred             HHCCCCCCEEEEEEEECCEEEEECCCCCCEEEE-----------------------CCCCCCEEEECCCCCCCCCCEEE
Q ss_conf             112444861551233232476631777507861-----------------------11243202323557777000123
Q gi|254781128|r   63 SKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYG-----------------------ASLGVEGFHLEPRGGIDGDKVAG  118 (225)
Q Consensus        63 skidhqspvrlqnlslngvsigldgqdgtlvyg-----------------------aslgvegfhleprggidgdkvag  118 (225)
                      ++.-...+++..+|-|.|=+|-.||+. ||+--                       ..||++-...-|.| +.||..-|
T Consensus       140 a~~~~~~~~~~~~lvlEGG~i~~dG~G-tlltTe~~ll~~nRNp~ls~~~ie~~Lk~~LGv~~viwl~~g-l~~DdTdG  216 (364)
T d2jera1         140 CEIEHVDSYRTDDFVLEGGSFHVDGQG-TVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVEKVLWLGDG-IDPEETNG  216 (364)
T ss_dssp             HHHHTCCEEEEEEEECCGGGEEECSSS-EEEEEHHHHTSTTTCTTSCHHHHHHHHHHHHTCSEEEEECCC-SCTTTTSS
T ss_pred             HHHHCCCCCCCCCEEECCCCEEECCCC-EEEEEHHHHHCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCC-CCCCCCCC
T ss_conf             998366544665737748966977996-399754555145789998999999999998698636776587-55677777


No 6  
>d1pwaa_ b.42.1.1 (A:) Fibroblast growth factor-19 (FGF19) {Human (Homo sapiens) [TaxId: 9606]}
Probab=14.09  E-value=32  Score=13.38  Aligned_cols=44  Identities=20%  Similarity=0.298  Sum_probs=24.1

Q ss_pred             CCCCCEEEECCCCCCCCCCEEEEEEEEEEEEECCCCHHHEEEEEEEEECCHHHHHE
Q ss_conf             12432023235577770001236676410122078501000001133252321000
Q gi|254781128|r   97 SLGVEGFHLEPRGGIDGDKVAGTLLFRTGFTFDNNNSSILQNTLIYGFGGARIRNI  152 (225)
Q Consensus        97 slgvegfhleprggidgdkvagtllfrtgftfdnnnssilqntliygfggarirni  152 (225)
                      +.|..||||+-..  || +|.||        -|++..++|+-. -.+.|-.+|+++
T Consensus        12 ~~~~~g~~L~I~~--dG-~V~Gt--------~d~s~~silei~-sv~~g~V~I~gv   55 (136)
T d1pwaa_          12 PHGLSSCFLRIRA--DG-VVDCA--------RGQSAHSLLEIK-AVALRTVAIKGV   55 (136)
T ss_dssp             TTSCCCEEEEECT--TS-BEEEE--------SSCCGGGCEEEE-EEETTEEEEEET
T ss_pred             CCCCCCEEEEECC--CC-CCCCE--------ECCCCCEEEEEE-CCCCCEEEEEEC
T ss_conf             7787618899889--98-59453--------079977799997-256888999974


No 7  
>d2gova1 d.60.1.4 (A:7-190) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=12.91  E-value=38  Score=12.95  Aligned_cols=19  Identities=32%  Similarity=0.585  Sum_probs=14.8

Q ss_pred             HHCCCCEEEEEEECCCCCH
Q ss_conf             3003533588961687654
Q gi|254781128|r  190 LSIRGEYRYVACYDQPWDV  208 (225)
Q Consensus       190 lsirgeyryvacydqpwdv  208 (225)
                      +.+.+++.|+|-||.||..
T Consensus       154 ~~~~~~~~~~a~Yd~P~~p  172 (184)
T d2gova1         154 ATYQGDVYYCAGYDPPMKP  172 (184)
T ss_dssp             CCEEEEEEEEEESSCCSSS
T ss_pred             CCCCCCCEEEEEECCCCCC
T ss_conf             9514897899992999987


No 8  
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}
Probab=12.52  E-value=29  Score=13.63  Aligned_cols=45  Identities=13%  Similarity=0.207  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHHHHCCHHHHHHHH-HHCCCCEEEEEEECCCCCHHHH
Q ss_conf             988641006776503326777775-3003533588961687654555
Q gi|254781128|r  166 RNIVANGFLDKVIGVGIEKKLASM-LSIRGEYRYVACYDQPWDVSKW  211 (225)
Q Consensus       166 rnivangfldkvigvgiekklasm-lsirgeyryvacydqpwdvskw  211 (225)
                      |+-+-+.|-+.-+.+-|-...++. +.+ ..-.+|-+||.||+...+
T Consensus       208 ~~~~~~~F~~g~~~vLv~T~~~~~Gld~-~~~~~Vi~~d~~~~~~~~  253 (286)
T d1wp9a2         208 QKLILDEFARGEFNVLVATSVGEEGLDV-PEVDLVVFYEPVPSAIRS  253 (286)
T ss_dssp             HHHHHHHHHHTSCSEEEECGGGGGGGGS-TTCCEEEESSCCHHHHHH
T ss_pred             HHHHHHHHHCCCCCEEEECCCEECCCCC-CCCCEEEEECCCCCHHHH
T ss_conf             9999999876998299971440203668-889989995899898999


No 9  
>d2i4ra1 c.149.1.1 (A:4-79) V-type ATP synthase subunit F, AtpF {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=10.80  E-value=29  Score=13.62  Aligned_cols=32  Identities=22%  Similarity=0.359  Sum_probs=25.7

Q ss_pred             EEEEECCHHHHHEEECCCCCHHHHHHHHHHHH
Q ss_conf             11332523210001102220257889988641
Q gi|254781128|r  140 LIYGFGGARIRNIMSVESADTAKSTIRNIVAN  171 (225)
Q Consensus       140 liygfggarirnimsvesadtakstirnivan  171 (225)
                      .+.||--|-+.++..|++.+.+..+++...++
T Consensus         9 tv~GF~LaGi~~~~~v~~~ee~~~~i~~~~~~   40 (76)
T d2i4ra1           9 FTIGFMLAGISDIYEVTSDEEIVKAVEDVLKR   40 (76)
T ss_dssp             HHHHHHHTTCCCEEECCSHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCC
T ss_conf             88999981877641579989999999998507


No 10 
>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]}
Probab=9.91  E-value=35  Score=13.19  Aligned_cols=30  Identities=13%  Similarity=0.106  Sum_probs=13.9

Q ss_pred             ECCEEEEECCCCCCEEEECCCCCCEEEECCCC
Q ss_conf             23247663177750786111243202323557
Q gi|254781128|r   78 LNGVSIGLDGQDGTLVYGASLGVEGFHLEPRG  109 (225)
Q Consensus        78 lngvsigldgqdgtlvygaslgvegfhleprg  109 (225)
                      -||--..++ .||.++--++- .+.|.+|-++
T Consensus        46 ~~gkyw~~~-~dG~l~~~~~~-~~~F~le~~~   75 (111)
T d1dfca4          46 STGKYWTVG-SDSAVTSSGDT-PVDFFFEFCD   75 (111)
T ss_dssp             TTSCBCEEC-SSCBEESCCSS-CCCBEEEEEE
T ss_pred             CCCCEEEEC-CCCCEEECCCC-CCCEEEEEEC
T ss_conf             899988885-89868757889-9888999958


Done!