RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781128|ref|YP_003065541.1| hypothetical protein CLIBASIA_05150 [Candidatus Liberibacter asiaticus str. psy62] (225 letters) >gnl|CDD|184149 PRK13568, hofQ, putative outer membrane porin HofQ; Provisional. Length = 381 Score = 29.3 bits (66), Expect = 0.88 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Query: 64 KIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYGASLGVE-GFHLEPRGGIDGDKVAGTLLF 122 K Q+ + Q L L +++ L D V SL + G L PRG + DK TLL Sbjct: 68 KTKQQAAPQEQMLPLANLTLTLQYADAEEV-ADSLQSQRGGLLSPRGSVTADKRTNTLLI 126 Query: 123 R 123 R Sbjct: 127 R 127 >gnl|CDD|162346 TIGR01414, autotrans_barl, outer membrane autotransporter barrel domain. A number of Gram-negative bacterial proteins, mostly found in pathogens and associated with virulence, contain a conserved C-terminal domain that integrates into the outer membrane and enables the N-terminal region to be delivered across the membrane. This C-terminal autotransporter domain is about 400 amino acids in length and includes the aromatic amino acid-rich OMP signal, typically ending with a Phe or Trp residue, at the extreme C-terminus. Length = 429 Score = 27.7 bits (62), Expect = 2.3 Identities = 27/126 (21%), Positives = 41/126 (32%), Gaps = 27/126 (21%) Query: 94 YGASLGVEGFHLEPRG---------------------GIDGDKVAGTLLFRTGFTFDNNN 132 Y +LG G+++EP+ G GD + G L R G+ FD Sbjct: 290 YRYNLGGNGWYVEPQAQLSYFGVSGDDYKESNGTRVLGGGGDSLQGRLGLRVGYQFDLGT 349 Query: 133 SSILQNTLIYGFGGARIRNIMSVESADTAKSTIRNIVANGFLDKVIGVGIEKKLASMLSI 192 ++ L TIR + GVG+ K+ S LS+ Sbjct: 350 GRAVKPYLKANVLHEFKGGT----GVRVNGVTIRTDFSGTRG--EYGVGVNAKIKSNLSL 403 Query: 193 RGEYRY 198 + Y Sbjct: 404 YADVDY 409 >gnl|CDD|184135 PRK13551, PRK13551, agmatine deiminase; Provisional. Length = 362 Score = 26.8 bits (60), Expect = 4.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 9/47 (19%) Query: 55 GLY--------VAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLV 93 GLY VA +I+ + R + L G SI +DG+ GTL+ Sbjct: 120 GLYFPWDKDDQVAQKVLEIEGRDRYRAKPFVLEGGSIHVDGE-GTLL 165 >gnl|CDD|162191 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily. Length = 726 Score = 27.0 bits (60), Expect = 4.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Query: 141 IYGFGGARIRNIMSVE 156 IYG+ GA I+NI+S E Sbjct: 249 IYGWRGADIQNILSFE 264 >gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. Length = 694 Score = 25.9 bits (57), Expect = 8.1 Identities = 12/48 (25%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 1 MRDIRKIRNYFRNTAKIILSGLFLGFFSSAAMADYGYSPQFQPTIMVS 48 +R++ +IRN+ +A ++ L A M + YSP ++ S Sbjct: 242 VRELEQIRNFLTGSALTVVLDLLFVVVFLAVM--FFYSPTLTGVVIGS 287 >gnl|CDD|184481 PRK14058, PRK14058, acetylglutamate/acetylaminoadipate kinase; Provisional. Length = 268 Score = 26.0 bits (58), Expect = 8.2 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Query: 56 LYVAADFSKIDHQSPVRLQNLSLNGVSIGLDGQDGTLVYG 95 +++ A + I+ Q RLQ+L +N ++GL G DG L+ G Sbjct: 73 VFIMA-MALINKQLVERLQSLGVN--AVGLSGLDGGLLEG 109 >gnl|CDD|132620 TIGR03581, EF_0839, conserved hypothetical protein EF_0839/AHA_3917. Members of this family of relatively uncommon proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown. Length = 236 Score = 25.9 bits (57), Expect = 8.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Query: 101 EGFHLEPRGGIDGDKVA 117 GF+LEP GGID D Sbjct: 176 HGFYLEPTGGIDLDNFE 192 >gnl|CDD|115707 pfam07071, DUF1341, Protein of unknown function (DUF1341). This family consists of several hypothetical bacterial proteins of around 220 residues in length. The function of this family is unknown. Length = 218 Score = 25.8 bits (57), Expect = 8.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Query: 101 EGFHLEPRGGIDGD 114 GF+LEP GGID D Sbjct: 176 HGFYLEPTGGIDLD 189 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.140 0.412 Gapped Lambda K H 0.267 0.0669 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,689,989 Number of extensions: 230105 Number of successful extensions: 445 Number of sequences better than 10.0: 1 Number of HSP's gapped: 445 Number of HSP's successfully gapped: 20 Length of query: 225 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 135 Effective length of database: 4,049,753 Effective search space: 546716655 Effective search space used: 546716655 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.1 bits)