Query         gi|254781129|ref|YP_003065542.1| hypothetical protein CLIBASIA_05155 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 103
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 21:55:16 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781129.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2wvr_C DNA replication factor   9.2      79  0.0023   14.7   0.0   52   52-103   491-542 (546)
  2 >1vk9_A Conserved hypothetical   7.8      55  0.0016   15.5  -1.3   20   81-100    21-40  (151)
  3 >2b2a_A Telomerase reverse tra   7.5 1.4E+02   0.004   13.5   0.6   15   54-68     10-24  (199)
  4 >3lsg_A Two-component response   5.8 1.7E+02  0.0051   13.0   0.4   12   28-39     26-37  (45)
  5 >3gox_A Restriction endonuclea   4.9      96  0.0028   14.3  -1.4   44   46-89      5-48  (71)
  6 >1dkg_D Molecular chaperone DN   4.7 2.3E+02   0.007   12.3   0.5   15   16-30     27-41  (41)
  7 >2kho_A Heat shock protein 70;   4.7 2.3E+02   0.007   12.3   0.5   15   16-30     27-41  (41)
  8 >2ob5_A AGR_C_3656P, hypotheti   4.6 2.1E+02  0.0063   12.5   0.2   23   44-66     64-86  (153)
  9 >2ivy_A Hypothetical protein S   4.3 2.6E+02  0.0077   12.1   0.5   20    8-27     19-38  (101)
 10 >2itb_A TRNA-(MS(2)IO(6)A)-hyd   3.9 2.3E+02  0.0068   12.4  -0.0   10    8-17     41-50  (89)

No 1  
>>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* (C:)
Probab=9.19  E-value=79  Score=14.71  Aligned_cols=52  Identities=12%  Similarity=0.204  Sum_probs=34.5

Q ss_pred             CHHHHHHHHEEEEEECCCHHHHHHHHCCCEEEEEECCCEEEEEECCCHHCCC
Q ss_conf             7655222110100105781235655205034454046323663233200039
Q gi|254781129|r   52 DDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE  103 (103)
Q Consensus        52 ddqkinniilskamvfpnqsdiaslkegvalnlvkdeslscviaegekleke  103 (103)
                      +...+..+|---+-+.|..-.|..+..+..|.+.|+-+|.-|+++-|++.||
T Consensus       491 ~~~e~~~~l~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  542 (546)
T 2wvr_C          491 SPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQTRA  542 (546)
T ss_dssp             ----------------------------------------------------
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             9999999999999868720699862794589960217999999999999766


No 2  
>>1vk9_A Conserved hypothetical protein TM1506; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; HET: UNL; 2.70A {Thermotoga maritima} (A:)
Probab=7.81  E-value=55  Score=15.50  Aligned_cols=20  Identities=25%  Similarity=0.453  Sum_probs=13.4

Q ss_pred             EEEEEECCCEEEEEECCCHH
Q ss_conf             34454046323663233200
Q gi|254781129|r   81 ALNLVKDESLSCVIAEGEKL  100 (103)
Q Consensus        81 alnlvkdeslscviaegekl  100 (103)
                      +.+|.+.+.+|||+..|..+
T Consensus        21 ~~~lL~e~~yS~Vv~~~~~I   40 (151)
T 1vk9_A           21 ALKIFEKKDLSLLAYSGRSI   40 (151)
T ss_dssp             HHHHHHHTTCSEEEESSSEE
T ss_pred             HHHHHHHCCEEEEEECCCEE
T ss_conf             99999708857999779899


No 3  
>>2b2a_A Telomerase reverse transcriptase; TERT, RT, transferase; 2.22A {Tetrahymena thermophila} (A:)
Probab=7.53  E-value=1.4e+02  Score=13.53  Aligned_cols=15  Identities=53%  Similarity=0.503  Sum_probs=5.7

Q ss_pred             HHHHHHHEEEEEECC
Q ss_conf             552221101001057
Q gi|254781129|r   54 QKINNIILSKAMVFP   68 (103)
Q Consensus        54 qkinniilskamvfp   68 (103)
                      ||||||--.|.|.-.
T Consensus        10 qkinninnnkqmltr   24 (199)
T 2b2a_A           10 QKINNINNNKQMLTR   24 (199)
T ss_dssp             -----------CCBC
T ss_pred             HHHCCCCCHHHHHHH
T ss_conf             885064543777644


No 4  
>>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} (A:1-45)
Probab=5.79  E-value=1.7e+02  Score=13.00  Aligned_cols=12  Identities=50%  Similarity=0.811  Sum_probs=9.6

Q ss_pred             HHHHCCCHHHCC
Q ss_conf             345010144347
Q gi|254781129|r   28 PEKMKLSQDYLG   39 (103)
Q Consensus        28 pekmklsqdylg   39 (103)
                      .|+|.||-.||.
T Consensus        26 ae~lnLSSGYLS   37 (45)
T 3lsg_A           26 SEKLDLSSGYLS   37 (45)
T ss_dssp             HHHTTCCHHHHH
T ss_pred             HHHHCCCHHHHH
T ss_conf             999891999999


No 5  
>>3gox_A Restriction endonuclease HPY99I; endonuclease-DNA complex, restriction enzyme, HPY99I, pseudopalindrome; HET: 1PE; 1.50A {Helicobacter pylori J99} PDB: 3fc3_A* (A:113-183)
Probab=4.86  E-value=96  Score=14.27  Aligned_cols=44  Identities=27%  Similarity=0.293  Sum_probs=25.1

Q ss_pred             HHHCCCCHHHHHHHHEEEEEECCCHHHHHHHHCCCEEEEEECCC
Q ss_conf             11025776552221101001057812356552050344540463
Q gi|254781129|r   46 VNQLNLDDQKINNIILSKAMVFPNQSDIASLKEGVALNLVKDES   89 (103)
Q Consensus        46 vnqlnlddqkinniilskamvfpnqsdiaslkegvalnlvkdes   89 (103)
                      |.--|-...+...|.-.|.-+|.-.---..---||..|||.|..
T Consensus         5 vkls~~ekk~md~iappkgsiftcpicekrsivgvtanlv~dhn   48 (71)
T 3gox_A            5 VKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHN   48 (71)
T ss_dssp             SCCCHHHHHHHHTTCCCTTCEEECTTTCCEEEBTTTBCEEEEEC
T ss_pred             HCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECC
T ss_conf             11012555655403556788875878798766777677356657


No 6  
>>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} (D:74-114)
Probab=4.72  E-value=2.3e+02  Score=12.31  Aligned_cols=15  Identities=20%  Similarity=0.182  Sum_probs=10.9

Q ss_pred             CEEEEEEEECCCHHH
Q ss_conf             002366751258345
Q gi|254781129|r   16 FATTQVQYSTFTPEK   30 (103)
Q Consensus        16 fattqvqystftpek   30 (103)
                      -+--+|+|-+|+||.
T Consensus        27 ~~~i~v~~k~~sPeE   41 (41)
T 1dkg_D           27 DAWVEVKGQKMAPPQ   41 (41)
T ss_dssp             BEEEEETTEEECHHH
T ss_pred             CEEEEECCEEECHHH
T ss_conf             469998888985999


No 7  
>>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} (A:74-114)
Probab=4.72  E-value=2.3e+02  Score=12.31  Aligned_cols=15  Identities=20%  Similarity=0.182  Sum_probs=11.1

Q ss_pred             CEEEEEEEECCCHHH
Q ss_conf             002366751258345
Q gi|254781129|r   16 FATTQVQYSTFTPEK   30 (103)
Q Consensus        16 fattqvqystftpek   30 (103)
                      -+--+|+|-+|+||.
T Consensus        27 ~~~i~v~~k~~sPeE   41 (41)
T 2kho_A           27 DAWVEVKGQKMAPPQ   41 (41)
T ss_dssp             BEEEEETTEEECHHH
T ss_pred             CEEEEECCEEECHHH
T ss_conf             579998999985999


No 8  
>>2ob5_A AGR_C_3656P, hypothetical protein ATU2016; putavite sugar binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.60A {Agrobacterium tumefaciens str} (A:)
Probab=4.63  E-value=2.1e+02  Score=12.54  Aligned_cols=23  Identities=9%  Similarity=0.012  Sum_probs=10.8

Q ss_pred             HHHHHCCCCHHHHHHHHEEEEEE
Q ss_conf             12110257765522211010010
Q gi|254781129|r   44 DAVNQLNLDDQKINNIILSKAMV   66 (103)
Q Consensus        44 davnqlnlddqkinniilskamv   66 (103)
                      .+|-.+-+.|..+...++...++
T Consensus        64 ~~VL~~l~~d~~Ve~~v~~~e~~   86 (153)
T 2ob5_A           64 KAILSVLPLDTPLQPSVGRXEVX   86 (153)
T ss_dssp             HHHHTTCCBCTTTSCCEEEECBT
T ss_pred             HHHHHHHHHCCCCCHHHHHCCCC
T ss_conf             99999742003320567750056


No 9  
>>2ivy_A Hypothetical protein SSO1404; structural genomics,unknown function, structural genomics, unknown function, CAS, RNAI, crispr; 1.4A {Sulfolobus solfataricus} (A:)
Probab=4.33  E-value=2.6e+02  Score=12.10  Aligned_cols=20  Identities=25%  Similarity=0.325  Sum_probs=13.9

Q ss_pred             HHHHHCCCCEEEEEEEECCC
Q ss_conf             64310011002366751258
Q gi|254781129|r    8 KAASNALNFATTQVQYSTFT   27 (103)
Q Consensus         8 kaasnalnfattqvqystft   27 (103)
                      |.+.--..|+-+.||||.|.
T Consensus        19 kv~k~L~~yGl~rvQ~SVFe   38 (101)
T 2ivy_A           19 RVAEFLKKKGLDRIQYSVFM   38 (101)
T ss_dssp             HHHHHHHHTTCEEEETTEEE
T ss_pred             HHHHHHHHHCCCCEEEEEEE
T ss_conf             99999998498113742899


No 10 
>>2itb_A TRNA-(MS(2)IO(6)A)-hydroxylase, putative; NP_744337.1, putative tRNA-(MS(2)IO(6)A)-hydroxylase, structural genomics, PSI-2; 2.05A {Pseudomonas putida KT2440} (A:1-89)
Probab=3.93  E-value=2.3e+02  Score=12.37  Aligned_cols=10  Identities=60%  Similarity=0.640  Sum_probs=6.5

Q ss_pred             HHHHHCCCCE
Q ss_conf             6431001100
Q gi|254781129|r    8 KAASNALNFA   17 (103)
Q Consensus         8 kaasnalnfa   17 (103)
                      |||++|+++-
T Consensus        41 KAA~tAl~Li   50 (89)
T 2itb_A           41 KAASTALSLI   50 (89)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
T ss_conf             9999999999


Done!