BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781129|ref|YP_003065542.1| hypothetical protein
CLIBASIA_05155 [Candidatus Liberibacter asiaticus str. psy62]
         (103 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781129|ref|YP_003065542.1| hypothetical protein CLIBASIA_05155 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040806|gb|ACT57602.1| hypothetical protein CLIBASIA_05155 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 103

 Score =  203 bits (516), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII 60
           MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII
Sbjct: 1   MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII 60

Query: 61  LSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE 103
           LSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE
Sbjct: 61  LSKAMVFPNQSDIASLKEGVALNLVKDESLSCVIAEGEKLEKE 103


>gi|315122524|ref|YP_004063013.1| hypothetical protein CKC_03880 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495926|gb|ADR52525.1| hypothetical protein CKC_03880 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 138

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 55/78 (70%)

Query: 1   MLRDGLHKAASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKINNII 60
           M R+ LH AASNAL FA  + + S+ T E ++ +QDYL +TNPDA+N LN+DDQK+ NI+
Sbjct: 52  MFRNSLHLAASNALKFAMAKFKSSSLTSEVLESAQDYLRSTNPDALNYLNIDDQKMTNIL 111

Query: 61  LSKAMVFPNQSDIASLKE 78
           +SK+    ++    SLKE
Sbjct: 112 ISKSFSSQDKLSDPSLKE 129


>gi|326676339|ref|XP_002665489.2| PREDICTED: a-kinase anchor protein 9 [Danio rerio]
          Length = 2679

 Score = 35.9 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 9   AASNALNFATTQVQYSTFTPEKMKLSQDYLGNTNPDAVNQLNLDDQKI 56
           A SNAL     QVQ  T  PE+MKL  + L N +    N L L D+++
Sbjct: 729 AESNALRLQCEQVQVETRDPEEMKLKMEELTNES----NTLQLQDEQL 772


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.310    0.127    0.338 

Lambda     K      H
   0.267   0.0394    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 788,863,218
Number of Sequences: 14124377
Number of extensions: 24371615
Number of successful extensions: 51861
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 51858
Number of HSP's gapped (non-prelim): 4
length of query: 103
length of database: 4,842,793,630
effective HSP length: 72
effective length of query: 31
effective length of database: 3,825,838,486
effective search space: 118600993066
effective search space used: 118600993066
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 75 (33.6 bits)