RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781130|ref|YP_003065543.1| hypothetical protein CLIBASIA_05160 [Candidatus Liberibacter asiaticus str. psy62] (378 letters) >gnl|CDD|38865 KOG3661, KOG3661, KOG3661, Uncharacterized conserved protein [Function unknown]. Length = 1019 Score = 40.5 bits (94), Expect = 9e-04 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 5/106 (4%) Query: 260 SDERLKK-VHGESSASAREIIEQLKFIDFNYLPE----SGMDSELRYLIGFSENNLKEIN 314 SD RLK+ + + A E + +L+ +D+ Y PE G++ R G LK + Sbjct: 485 SDIRLKEHITEVDTTEALENLSKLRLVDYRYKPEVAASWGLEETQRPRTGVIAQELKAVL 544 Query: 315 EVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEE 360 V G YL N + A QEL + +L ID++ E Sbjct: 545 PDAVKDTGDYLTVNEERVFYETVGATQELCRLTGDLDTKIDEKVAE 590 >gnl|CDD|37578 KOG2367, KOG2367, KOG2367, Alpha-isopropylmalate synthase/homocitrate synthase [Amino acid transport and metabolism]. Length = 560 Score = 31.9 bits (72), Expect = 0.31 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 7/73 (9%) Query: 253 VGCSYFLSDERLKKVHGESSASAREIIE---QLKFIDFNYLPESGMDSELRYLIGFSENN 309 + S + +LKK E SA E+I+ L D + PE SEL +L+ Sbjct: 154 IATSDIHREYKLKKSKEEVIESAVEVIKFVKSLGKWDIEFSPEDFGRSELEFLL----EI 209 Query: 310 LKEINEVFVDTIG 322 L + + V T+ Sbjct: 210 LGAVIKAGVTTVN 222 >gnl|CDD|144619 pfam01093, Clusterin, Clusterin. Length = 460 Score = 29.7 bits (67), Expect = 1.2 Identities = 13/60 (21%), Positives = 29/60 (48%), Gaps = 21/60 (35%) Query: 306 SENNLKEINEV---FVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQ 362 S+N LK+++E +VD + ++ L VK+++ ++++ EEH+ Sbjct: 25 SKNELKQLSEEGEKYVD------------------EEVENALIGVKQMKTLMERTEEEHK 66 >gnl|CDD|99994 cd03825, GT1_wcfI_like, This family is most closely related to the GT1 family of glycosyltransferases. wcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.. Length = 365 Score = 29.1 bits (66), Expect = 2.1 Identities = 12/51 (23%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Query: 303 IGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDM 353 + F + +I + GYLA LA+ I+ LL + E ++ Sbjct: 292 VAFDVGGIPDI---VDHGVTGYLAKPGDP--EDLAEGIEWLLADPDEREEL 337 >gnl|CDD|34223 COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms]. Length = 365 Score = 29.0 bits (64), Expect = 2.2 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 1/86 (1%) Query: 260 SDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVD 319 E+ ++ E RE +++++ + + P L + + +E + VD Sbjct: 203 DAEKAQEELKEIEKLLREALQEVRALVRDLRPVELEGLGLVEALRALLADFEERTGITVD 262 Query: 320 -TIGGYLAPNPSVIIPHLAKAIQELL 344 ++G L P L + +QE L Sbjct: 263 LSLGSELERLPPEAEDALFRIVQEAL 288 >gnl|CDD|39772 KOG4572, KOG4572, KOG4572, Predicted DNA-binding transcription factor, interacts with stathmin [Transcription, General function prediction only, Signal transduction mechanisms]. Length = 1424 Score = 29.0 bits (64), Expect = 2.4 Identities = 24/115 (20%), Positives = 40/115 (34%), Gaps = 12/115 (10%) Query: 262 ERLKKVHGESSASAREIIE----QLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVF 317 + L+ + E EII+ +L +F L ES +++ E + EI Sbjct: 1016 KELEAIINEIEELEAEIIQEKEGELIEDEFKALDESDPRAKIEDEFAAIEAEMDEI---- 1071 Query: 318 VDTIGGYLAPNPSVIIPH--LAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNT 370 G I ++ L E+++L D I NE Q N+ Sbjct: 1072 --KDGKCEDRAKQKEIDKILKEHELENLRNEIEKLNDKIKDNNEGDQVGLAEENS 1124 >gnl|CDD|144389 pfam00771, FHIPEP, FHIPEP family. Length = 658 Score = 28.9 bits (66), Expect = 2.5 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 6/36 (16%) Query: 329 PSVIIPHLAKAIQ----ELL--QEVKELRDMIDKQN 358 +VI HL++ ++ ELL QEV++L D ++K+ Sbjct: 455 ATVIATHLSEVLRRHAAELLGRQEVQKLLDRLEKEY 490 >gnl|CDD|36109 KOG0891, KOG0891, KOG0891, DNA-dependent protein kinase [Replication, recombination and repair]. Length = 2341 Score = 28.4 bits (63), Expect = 3.0 Identities = 18/76 (23%), Positives = 31/76 (40%) Query: 273 ASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVI 332 I L ++ + + LR L + I E+ IG + NP+ + Sbjct: 541 TDPDIRIRVLSSLNERFDAQLAQPDLLRLLFIALHDENFAIQELATVIIGRLSSYNPAYV 600 Query: 333 IPHLAKAIQELLQEVK 348 +P L K + ELL E++ Sbjct: 601 LPSLRKTLLELLTELE 616 >gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. Length = 211 Score = 28.3 bits (64), Expect = 3.5 Identities = 15/69 (21%), Positives = 26/69 (37%), Gaps = 14/69 (20%) Query: 183 YNNSQRIAAFLDDGDIMCYKRQKTVWQGIEI-------AQHTANIALESTKNCLYKTTVL 235 YN +R+ L+ + + Y ++ EI TA +A + + VL Sbjct: 6 YNEEKRLPPTLE--EAVEYL-EERPSFSYEIIVVDDGSKDGTAEVARKLARKNPALIRVL 62 Query: 236 ----NMGRG 240 N G+G Sbjct: 63 TLPKNRGKG 71 >gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown. Length = 257 Score = 27.6 bits (61), Expect = 6.5 Identities = 16/63 (25%), Positives = 25/63 (39%), Gaps = 10/63 (15%) Query: 309 NLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMS 368 N K++N + I G L P P P L + I M+ K+ E+ V+ + Sbjct: 203 NAKDMNSLVYRIIEGKLPPMPKDYSPELGELIAT----------MLSKRPEKRPSVKSIL 252 Query: 369 NTP 371 P Sbjct: 253 RQP 255 >gnl|CDD|35737 KOG0517, KOG0517, KOG0517, Beta-spectrin [Cytoskeleton]. Length = 2473 Score = 27.3 bits (60), Expect = 7.3 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query: 336 LAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQ 375 LA+A ++LL++ LR+ ID E++Q ++ + T + Q Sbjct: 1089 LAEA-EQLLKQHAALREEIDGYQEDYQRMRALGETVADGQ 1127 >gnl|CDD|146980 pfam04599, Pox_G5, Poxvirus G5 protein. This protein has been predicted to be related to the FEN-1 endonuclease. Length = 426 Score = 27.3 bits (61), Expect = 7.4 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 307 ENNLKEINEVFVDTIGGYLA 326 +N K INE+FVDT+ +++ Sbjct: 20 DNIEKNINEIFVDTMSIFMS 39 >gnl|CDD|39842 KOG4643, KOG4643, KOG4643, Uncharacterized coiled-coil protein [Function unknown]. Length = 1195 Score = 27.0 bits (59), Expect = 8.8 Identities = 28/105 (26%), Positives = 39/105 (37%), Gaps = 6/105 (5%) Query: 273 ASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVI 332 A E+ EQ K D Y S EL L+G NL+E N + I S Sbjct: 509 ALKNELKEQYKTCDIQYELLSNKLEELEELLG----NLEEENAHLLKQI--QSLKTTSQN 562 Query: 333 IPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQKF 377 L + +L EL+ ID N + + + +N Q F Sbjct: 563 GALLEQNNNDLELIHNELKKYIDALNALRRHKEKLEEEIMNQQLF 607 >gnl|CDD|112906 pfam04111, APG6, Autophagy protein Apg6. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. Autophagy is a bulk degradation process induced by starvation in eukaryotic cells. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway. Length = 356 Score = 27.1 bits (60), Expect = 8.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 333 IPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQ 365 + L K + LL E++EL D + E ++Q Sbjct: 72 LDELKKEEERLLDELEELEKEDDDLDGELVELQ 104 >gnl|CDD|146199 pfam03443, Glyco_hydro_61, Glycosyl hydrolase family 61. Length = 234 Score = 26.9 bits (60), Expect = 9.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Query: 171 LHQAIFQNGAQFY 183 LH A GAQFY Sbjct: 176 LHSAGSPGGAQFY 188 >gnl|CDD|37873 KOG2662, KOG2662, KOG2662, Magnesium transporters: CorA family [Inorganic ion transport and metabolism]. Length = 414 Score = 26.8 bits (59), Expect = 9.8 Identities = 9/32 (28%), Positives = 20/32 (62%) Query: 336 LAKAIQELLQEVKELRDMIDKQNEEHQDVQDM 367 L K + EL V+++RD +++ ++ D+ +M Sbjct: 225 LKKRLTELTSRVQKVRDELEELLDDDDDMAEM 256 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.133 0.387 Gapped Lambda K H 0.267 0.0722 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,436,003 Number of extensions: 229947 Number of successful extensions: 682 Number of sequences better than 10.0: 1 Number of HSP's gapped: 682 Number of HSP's successfully gapped: 25 Length of query: 378 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 283 Effective length of database: 4,210,882 Effective search space: 1191679606 Effective search space used: 1191679606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.1 bits)