RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781130|ref|YP_003065543.1| hypothetical protein CLIBASIA_05160 [Candidatus Liberibacter asiaticus str. psy62] (378 letters) >d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Score = 28.1 bits (61), Expect = 1.2 Identities = 13/53 (24%), Positives = 22/53 (41%) Query: 306 SENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQN 358 N K + E TIG P + P L + I+ ++ +RD +K + Sbjct: 758 RPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDS 810 >d1fx0b1 a.69.1.1 (B:378-485) F1 ATP synthase beta subunit, domain 3 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 108 Score = 27.7 bits (62), Expect = 1.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Query: 336 LAKAIQELLQEVKELRDMIDKQNEEHQDVQDM 367 +A+ ++E LQ KEL+D+I + +D Sbjct: 10 IAQRVKETLQRYKELQDIIAILGLDELSEEDR 41 >d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Length = 458 Score = 27.9 bits (62), Expect = 1.4 Identities = 7/42 (16%), Positives = 19/42 (45%) Query: 334 PHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQ 375 + ++ Q+ QE+ +L+ I + + + N+ N + Sbjct: 363 RSIDESSQQYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPK 404 >d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} Length = 114 Score = 27.3 bits (61), Expect = 2.3 Identities = 9/31 (29%), Positives = 18/31 (58%) Query: 336 LAKAIQELLQEVKELRDMIDKQNEEHQDVQD 366 +A+ +Q+ L+ KEL+D+I + +D Sbjct: 10 VARKVQQTLERYKELQDIIAILGMDELSDED 40 >d1bf5a1 a.47.1.1 (A:136-316) STAT-1, coiled coil domain {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Score = 27.1 bits (60), Expect = 2.5 Identities = 8/44 (18%), Positives = 21/44 (47%) Query: 335 HLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQKFD 378 ++ + + E+K L D+ D+ + + + +Q+ + K D Sbjct: 13 NVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSD 56 >d1j1ua_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 306 Score = 26.9 bits (58), Expect = 2.5 Identities = 17/237 (7%), Positives = 63/237 (26%), Gaps = 17/237 (7%) Query: 115 MREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQA 174 + ++ A+ + + + + L + +++ Sbjct: 83 RKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDE 142 Query: 175 IFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKT-VWQGIEIAQHTANIALESTKNCLYKTT 233 + Y Q D+ ++ + + + + Sbjct: 143 NPKVAEVIYPIMQVNDIHYLGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGE 202 Query: 234 VLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYL-PE 292 +I D +E K+ + + I +L Sbjct: 203 GKMSSSKGNFIAVDDSP----------EEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYP 252 Query: 293 SGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKE 349 + ++ + N+ +E+ +F + +P + +A+ + ++L+ +++ Sbjct: 253 LTIKRPEKFGGDLTVNSYEELESLFKN--KEL---HPMDLKNAVAEELIKILEPIRK 304 >d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Length = 584 Score = 26.7 bits (58), Expect = 3.2 Identities = 11/91 (12%), Positives = 33/91 (36%), Gaps = 10/91 (10%) Query: 271 SSASAREIIEQLKFIDFNYLPESGMDSELR----YLIGFSENNLKEINEVFVDTIGGYLA 326 ++A++I+ ++ +YL + D +R + +VDTI + Sbjct: 390 DRSNAQQIVAEML----SYLETA--DYSIREEIVLKVAILAEKYAVDYTWYVDTILNLIR 443 Query: 327 PNPSVIIPHLAKAIQELLQEVKELRDMIDKQ 357 + + + +++ +++ K Sbjct: 444 IAGDYVSEEVWYRVIQIVINRDDVQGYAAKT 474 >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Score = 26.1 bits (57), Expect = 4.5 Identities = 29/233 (12%), Positives = 65/233 (27%), Gaps = 34/233 (14%) Query: 139 NHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNG--AQFYNNSQRIAAFLDDG 196 + +V + A +RK+ + + + + G A R Sbjct: 38 DIVVLGVEKKSVAKLQDERTVRKICALDD----NVCMAFAGLTADARIVINRARVECQS- 92 Query: 197 DIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMG----RGPGYIHFDTDKGA 252 + + TV +S + + L +G P D Sbjct: 93 HRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTY 152 Query: 253 VGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKE 312 G + S RE +E+ + + + ++ L+ ++ K Sbjct: 153 HAWKAN--------AIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKN 204 Query: 313 INEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQ 365 I + NP +E+++ I+K+ EE++ + Sbjct: 205 IELAVMRRDQSLKILNP---------------EEIEKYVAEIEKEKEENEKKK 242 >d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Length = 459 Score = 25.9 bits (57), Expect = 5.1 Identities = 20/99 (20%), Positives = 25/99 (25%), Gaps = 20/99 (20%) Query: 110 VDLSSMREVWTSQLAPRALQNL-VDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNG 168 VD W L L N D+ K ++T N L Sbjct: 178 VDADKWEVAW-QVLVSGNLDNCDADYEGK---WAFSTSYNSEKGMTLPEMTAA------- 226 Query: 169 ETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTV 207 E H +F N I + GD K V Sbjct: 227 EMDHIVVF--------NIAEIEKAIAAGDYQELNGVKVV 257 >d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Score = 26.0 bits (57), Expect = 5.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 341 QELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQKFD 378 E ++V+E+R IDK E ++V+ + L S D Sbjct: 6 DEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPD 43 >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 133 Score = 25.6 bits (56), Expect = 6.7 Identities = 18/113 (15%), Positives = 38/113 (33%), Gaps = 11/113 (9%) Query: 262 ERLKKVHGESSASAREIIEQLKFIDF-NYLPESGMDSELRYLIG---FSENNLKEINEVF 317 +++ + + A I E + + SE +G F + LK+ +EV Sbjct: 15 SQVELIQQQMEAVRATISELEILEKTLSDIQGKD-GSETLVPVGAGSFIKAELKDTSEVI 73 Query: 318 VDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNT 370 + G A++ + + EL + K E + + D+ Sbjct: 74 MSVGAGVAIKKN------FEDAMESIKSQKNELESTLQKMGENLRAITDIMMK 120 >d2d0ta1 a.266.1.2 (A:12-403) Indoleamine 2,3-dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Length = 392 Score = 25.7 bits (56), Expect = 6.8 Identities = 9/45 (20%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Query: 318 VDTIGGYLAPNPSVIIPHLAKAIQELLQEVKEL------RDMIDK 356 +D G+ PNP +P + + + +L R+ ++K Sbjct: 6 IDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEK 50 >d1itwa_ c.77.1.2 (A:) Monomeric isocitrate dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 740 Score = 25.5 bits (56), Expect = 8.0 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 327 PNPSVIIPHLAKAIQELLQEVKELRDMIDK-QNEEHQDVQ 365 PN S +P L AI+EL Q+ +L D ++ + + +DV+ Sbjct: 83 PNISASVPQLKAAIKELQQQGYKLPDYPEEPKTDTEKDVK 122 >d2e50a1 d.305.1.1 (A:1-222) Protein SET {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Score = 24.9 bits (54), Expect = 10.0 Identities = 8/28 (28%), Positives = 17/28 (60%) Query: 336 LAKAIQELLQEVKELRDMIDKQNEEHQD 363 K QE ++ + E+++ ID+ NE+ + Sbjct: 24 SEKEQQEAIEHIDEVQNEIDRLNEQASE 51 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.133 0.387 Gapped Lambda K H 0.267 0.0654 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,366,675 Number of extensions: 62755 Number of successful extensions: 236 Number of sequences better than 10.0: 1 Number of HSP's gapped: 236 Number of HSP's successfully gapped: 24 Length of query: 378 Length of database: 2,407,596 Length adjustment: 87 Effective length of query: 291 Effective length of database: 1,213,086 Effective search space: 353008026 Effective search space used: 353008026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.7 bits)