HHsearch alignment of GI: 254781131 and MMDB domain: 3gw6_A_109-200_241-275

>3gw6_A (A:109-200,A:241-275) Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F}
Probab=99.64  E-value=3e-17  Score=113.60  Aligned_cols=69  Identities=14%  Similarity=0.054  Sum_probs=56.4

Q ss_pred             CCCCCCCCCHHHCCCCCCCC--------CEEEEEEEECC-------CCCEEEEECHHHHHHHCCCEEEECCCCEEEEEHH
Q ss_conf             33210013513105511245--------32227978718-------9856997756788853780184379846888620
Q gi|254781131|r   68 YQLAPLVSDRRMKCNVKPVA--------NLYQYRYLSDP-------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYG  132 (150)
Q Consensus        68 ~~~~~~~SD~RLK~NI~~I~--------~l~~~~y~~~~-------~~~~~~GvIAQEVe~v~Pe~V~~~~dg~~~VdY~  132 (150)
                      ++.+..+||+|||+||++++        +|++++|+|+.       ++.+++|||||||++++|++|..+. ++++++|.
T Consensus         7 ~~~~i~tSD~RlKtnI~~i~~~~Ld~I~~L~~vtY~~k~~~e~~~~~~r~~~G~IAQev~ev~Pe~V~~~~-d~~~~dy~   85 (127)
T 3gw6_A            7 GSNPIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDE-NSTNCRYA   85 (127)
T ss_dssp             SSCCEEECTTCCBCCCBCCCHHHHHHHTTCCCEEECBHHHHHHHGGGSCBEEECCHHHHHHHHHHTTSSCS-CC--CCBT
T ss_pred             CCCEEECCCCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC-CCCCCCCC
T ss_conf             37646445720124765588799999983797798876643335776532014103024443111045555-56532133


Q ss_pred             CHHHH
Q ss_conf             23679
Q gi|254781131|r  133 RLFNI  137 (150)
Q Consensus       133 ~L~~l  137 (150)
                      .|...
T Consensus        86 ~l~~~   90 (127)
T 3gw6_A           86 VLCYD   90 (127)
T ss_dssp             TEEEE
T ss_pred             EEECC
T ss_conf             33055