BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781131|ref|YP_003065544.1| hypothetical protein
CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62]
         (150 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040808|gb|ACT57604.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 150

 Score =  306 bits (784), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 150/150 (100%), Positives = 150/150 (100%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF
Sbjct: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
           YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV
Sbjct: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120

Query: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ
Sbjct: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150


>gi|315122526|ref|YP_004063015.1| hypothetical protein CKC_03890 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495928|gb|ADR52527.1| hypothetical protein CKC_03890 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 389

 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/146 (59%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +DQKQQA HEILSLMQ +   K PI+ NNP  I P+DY  I+QN YQN+  E K+ K+  
Sbjct: 244 IDQKQQALHEILSLMQTIPASKFPITQNNPIAITPVDYREISQNDYQNRFQEWKQRKQNI 303

Query: 61  YDAVNMGYQL-APLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
           YD++N+G +L   ++SDRRMK ++KPV NLYQYRY+SDPK  QRIGV+AQEI+KIRPD V
Sbjct: 304 YDSINIGNKLVGSILSDRRMKRDIKPVGNLYQYRYVSDPKRTQRIGVMAQEINKIRPDAV 363

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQK 145
           V+N+QG++SVDYG LFN  +I + +K
Sbjct: 364 VKNSQGLQSVDYGLLFNTSKILSPRK 389


>gi|150397020|ref|YP_001327487.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419]
 gi|150028535|gb|ABR60652.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419]
          Length = 532

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 81/143 (56%), Gaps = 10/143 (6%)

Query: 3   QKQQAFHEILSLMQNVTV--PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           Q+ Q  +EI+ LM    V  P    + +NP P   +DYAG+ Q  Y N++   ++ +   
Sbjct: 390 QRNQPINEIVGLMSGAQVDSPSFVPTQSNPMPT--VDYAGLVQQDYANKMGAYQQKQSTM 447

Query: 61  YDAVNMGY----QLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNV-QRIGVIAQEISKIR 115
            +          QLA L SD+R K ++K V  LY+YRY  + +N  +RIGV+AQE+ K+R
Sbjct: 448 QNLFGGMLGFGGQLASL-SDKRAKKDIKKVGGLYEYRYKGEGRNAPKRIGVMAQEVEKVR 506

Query: 116 PDTVVENNQGIKSVDYGRLFNIG 138
           PD V +   G++ VDYG LFN G
Sbjct: 507 PDAVAKGADGLRRVDYGLLFNAG 529


>gi|227822435|ref|YP_002826407.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234]
 gi|227341436|gb|ACP25654.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234]
          Length = 453

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 12/146 (8%)

Query: 4   KQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLS----ERKEGKKE 59
           + Q  +EI +L+    V            I P+DYAG+ Q  YQNQ++     ++ G   
Sbjct: 306 RNQPINEISALLSGAQVTTPNFVPTQGQSIQPVDYAGLVQQNYQNQMAAYNARQQSGGNL 365

Query: 60  FYDAVNMGYQLAPLVSDRRMKCNVKPVA-----NLYQYRYLSD-PKNVQRIGVIAQEISK 113
             + + M ++  PL SDRR K N++ V      NLY++ Y  +     + IGV+AQE+ +
Sbjct: 366 LGNVLGM-FEKIPL-SDRRAKKNIEKVGRLKAHNLYEFDYKGEQAGGPKHIGVMAQEVER 423

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQ 139
            RPD V+    G++ VDYGRLF  G 
Sbjct: 424 TRPDAVIRGPDGMRRVDYGRLFAAGH 449


>gi|110632598|ref|YP_672806.1| hypothetical protein Meso_0237 [Mesorhizobium sp. BNC1]
 gi|110283582|gb|ABG61641.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 322

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 17/144 (11%)

Query: 1   MDQKQQAFHEILSLMQNVTV--PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK 58
           + Q+ Q  +EI+ LM    V  P    +    + +A +DY G+    YQ  ++  + G  
Sbjct: 185 LAQRNQPLNEIIGLMSGTQVQNPNATFAQTPQSGVAGVDYTGLVNQKYQADVANYRAGMG 244

Query: 59  EFYDAVNMGYQLAPLV--SDRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQE 110
             +    +G  L  L+  SD R+K +++ V        +Y +RY  DP  V  IGV+AQE
Sbjct: 245 GLF---GLGSALIGLLPSSDERLKSDIRRVGTTDGGVPIYIFRYRDDPFKVWHIGVMAQE 301

Query: 111 ISKIRPDTVVENNQGIKSVDYGRL 134
           +    P+  V +  G   VDYGR+
Sbjct: 302 V----PEARVSDESGFFRVDYGRV 321


>gi|13470675|ref|NP_102244.1| hypothetical protein mll0449 [Mesorhizobium loti MAFF303099]
 gi|14021417|dbj|BAB48030.1| mll0449 [Mesorhizobium loti MAFF303099]
          Length = 230

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 64/145 (44%), Gaps = 10/145 (6%)

Query: 4   KQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQN-------QLSERKEG 56
           + Q  +EI +L+    V     +   P+ I   D AGI  N YQ        Q+S+    
Sbjct: 85  RNQPINEITALLSGSQVSNPQAAAYTPSTIPTTDNAGIIANNYQQKMDAYNAQMSQASSL 144

Query: 57  KKEFYDAVNMGYQLAP--LVSDRRMKCNVKPVANLYQYRYLSDPKNV-QRIGVIAQEISK 113
               +        L+      D+    ++ P   L+++ Y  +P +   R+G++A E+ K
Sbjct: 145 AGGLFGLGGKLISLSDDDAKKDKERLADITPEMGLWKFHYKGEPADAPMRLGLMASEVEK 204

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIG 138
           +RPD V     G + VDYG+  ++G
Sbjct: 205 VRPDAVSRRPDGYRQVDYGKALSLG 229


>gi|149925860|ref|ZP_01914124.1| Putative membrane-anchored cell surface protein, haemagluttinin
            [Limnobacter sp. MED105]
 gi|149825977|gb|EDM85185.1| Putative membrane-anchored cell surface protein, haemagluttinin
            [Limnobacter sp. MED105]
          Length = 2613

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 49/103 (47%), Gaps = 19/103 (18%)

Query: 62   DAVNMGYQLAP---LVSDRRMKCNVK-----------PVANLYQYRYLSDPKNVQRIGVI 107
            D +  GY  A    + SDRR+K N++                Y Y YL++P   +RIGVI
Sbjct: 2259 DVIASGYMQATAFNVSSDRRLKTNIQVQDTGSVLSRLEQLQTYSYEYLANPNLGRRIGVI 2318

Query: 108  AQEISKIRPDTVVENNQGIKSVDYGRL-----FNIGQIQTKQK 145
            AQEI  + P+ V     G+ SVDY  L       +GQ+  + K
Sbjct: 2319 AQEIQNLFPEAVATRADGMMSVDYSALGAMAAMGVGQLSKQVK 2361


>gi|126443127|ref|YP_001063336.1| hypothetical protein BURPS668_A2342 [Burkholderia pseudomallei 668]
 gi|126222618|gb|ABN86123.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 408

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP------LVSDRRMKCNVKPVA 87
           +P + A   QN Y  QL++   G       +   + L        L+SDRR K ++  + 
Sbjct: 293 SPANIAQAFQNQYAGQLNQYNTGVASANSTMGGLFGLGSAGLMGFLLSDRRSKTDIHAIG 352

Query: 88  ------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGR 133
                 N Y++RY  +     R G++A E+ ++RPD VV +  G   V+Y R
Sbjct: 353 PAGDGVNFYRFRYRWEAPGTVRHGLMADEVKRVRPDAVVRHPSGYDLVNYNR 404


>gi|167907339|ref|ZP_02494544.1| hypothetical protein BpseN_34235 [Burkholderia pseudomallei NCTC
           13177]
          Length = 399

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP------LVSDRRMKCNVKPVA 87
           +P + A   QN Y  QL++   G       +   + L        L+SDRR K ++  + 
Sbjct: 284 SPANIAQAFQNQYAGQLNQYNTGVASANSTMGGLFGLGSAGLMGFLLSDRRSKTDIHAIG 343

Query: 88  ------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGR 133
                 N Y++RY  +     R G++A E+ ++RPD VV +  G   V+Y R
Sbjct: 344 SVGDGVNFYRFRYRWEAPGTVRHGLMADEVKRVRPDAVVRHPSGYDLVNYNR 395


>gi|218673260|ref|ZP_03522929.1| hypothetical protein RetlG_17541 [Rhizobium etli GR56]
          Length = 334

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 22/149 (14%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAP-IDYAGI-------AQNIYQNQLSE 52
           + ++ Q  +EI +LM    V + P  +N PT   P +D AG+          +Y  Q+++
Sbjct: 189 LTERNQPLNEISALMSGSQVHQ-PNYVNTPTTQLPNVDQAGLINENFNQKMGLYDRQVAQ 247

Query: 53  RKEGKKEFYDAVNMGYQL--APLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRI 104
                   +    +G  L      SDRR+K ++K V  L      Y +RY        ++
Sbjct: 248 SNAAMGGLF---GLGSSLLGGWAKSDRRLKEDIKRVGTLENGLPVYAFRY--KEGGPMQL 302

Query: 105 GVIAQEISKIRPDTVVENNQGIKSVDYGR 133
           G+++ ++ K  PD VVE+  G   VDY R
Sbjct: 303 GLMSDDVRKTHPDAVVEHADGFDRVDYER 331


>gi|327191473|gb|EGE58493.1| hypothetical protein RHECNPAF_300003 [Rhizobium etli CNPAF512]
          Length = 335

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 17/147 (11%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAP-IDYAGI-------AQNIYQNQLSE 52
           + ++ Q  +EI +LM    V + P  +N PT   P +D AG+          +Y  Q+++
Sbjct: 189 LTERNQPLNEISALMSGSQVHQ-PNYVNTPTTQLPNVDQAGLINENFNQKMGLYDRQVAQ 247

Query: 53  RKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGV 106
                   +   +       + SDRR+K ++K V  L      Y +RY        ++G+
Sbjct: 248 SNAAMGGLFGLGSSLLGGWAMKSDRRLKEDIKRVGTLENGLPVYAFRY--KEGGPMQLGL 305

Query: 107 IAQEISKIRPDTVVENNQGIKSVDYGR 133
           ++ ++ K  PD V E+  G   VDY R
Sbjct: 306 MSDDVRKTHPDAVFEHADGFDRVDYER 332


>gi|319783503|ref|YP_004142979.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169391|gb|ADV12929.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 330

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 13/120 (10%)

Query: 25  ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQL-APLV--SDRRMKC 81
           ++ N PT I   D AG+    Y  QL + ++      D +   + L A L+  SDRR+K 
Sbjct: 214 VNANMPT-IPTTDTAGLINTNYNQQLQKWQQDASSSSDLMGGLFGLGANLIKFSDRRLKK 272

Query: 82  NVKPVANL------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF 135
           N++ +         Y + YL      +++GV+A E+   RP  V   N G  +VDYGR F
Sbjct: 273 NIRAIGTFANGLTKYVFEYLWGGG--EQVGVMADEVRAYRPYAVTTVN-GFDAVDYGRAF 329


>gi|316933872|ref|YP_004108854.1| hypothetical protein Rpdx1_2530 [Rhodopseudomonas palustris DX-1]
 gi|315601586|gb|ADU44121.1| hypothetical protein Rpdx1_2530 [Rhodopseudomonas palustris DX-1]
          Length = 341

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 61/145 (42%), Gaps = 20/145 (13%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQN-------IYQNQLSERKEGKKEF 60
            +EI +L+    V     S    T +A  DYAG+  N        Y N+L          
Sbjct: 195 INEITALLSGSQVSAPNYSSTPTTGVAGTDYAGMVSNNYGQQMQAYNNKLQSNNAAMGGM 254

Query: 61  YDAVNM----GYQLAPL---VSDRRMKCNV----KPVANLYQYRYLSDPKNVQRIGVIAQ 109
           +         G +  P    +SDRR+K ++    +  A L  Y Y    +  +  GV+A 
Sbjct: 255 FGLAGTLGAAGMKYGPTWMAMSDRRLKSDIVDTGETFAGLPVYEYTIFGR--RERGVMAD 312

Query: 110 EISKIRPDTVVENNQGIKSVDYGRL 134
           E+ ++ P+ V  +  G K VDYGRL
Sbjct: 313 EVEQVMPEAVALHPSGFKMVDYGRL 337


>gi|116253668|ref|YP_769506.1| hypothetical protein RL3928 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258316|emb|CAK09418.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 335

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 69/145 (47%), Gaps = 17/145 (11%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAP-IDYAGIAQNIYQNQL----SERKE 55
           + ++ Q  +EI +LM    V + P  +N PT   P +D AG+    Y  Q+    S+  +
Sbjct: 189 LTERNQPLNEISALMSGSQVNQ-PNYVNAPTTQLPTVDQAGLINENYNQQMGAYNSQVSK 247

Query: 56  GKKEFYDAVNMGYQL---APLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGV 106
                     +G  L     + SDRR+K ++K V  L      Y +RY        +IG+
Sbjct: 248 SNAAMGGLFGLGSSLLGGWAMGSDRRLKEDIKRVGTLDNGLPVYVFRY--KKGGPTQIGL 305

Query: 107 IAQEISKIRPDTVVENNQGIKSVDY 131
           ++ ++ ++ P++V E+ +G   VDY
Sbjct: 306 MSDDVREVHPESVFEDAEGFDRVDY 330


>gi|253583148|ref|ZP_04860356.1| predicted protein [Fusobacterium varium ATCC 27725]
 gi|251835040|gb|EES63593.1| predicted protein [Fusobacterium varium ATCC 27725]
          Length = 587

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 15/73 (20%)

Query: 75  SDRRMKCNVKPVAN---------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ- 124
           SD R+K N+KP+ N         +Y Y +    K  + IGVIAQE+ ++ P+ V+E +  
Sbjct: 489 SDIRLKENLKPLTNTLDIIDNLNVYHYNWKDTKK--EDIGVIAQEVEQVFPELVIEIDDP 546

Query: 125 ---GIKSVDYGRL 134
               IK VDYG+L
Sbjct: 547 VKGKIKGVDYGKL 559


>gi|313768276|ref|YP_004061956.1| hypothetical protein MpV1_073 [Micromonas sp. RCC1109 virus MpV1]
 gi|312598972|gb|ADQ90996.1| hypothetical protein MpV1_073 [Micromonas sp. RCC1109 virus MpV1]
          Length = 256

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 8/70 (11%)

Query: 73  LVSDRRMKCNVKPVAN----LYQYRYLSDPK----NVQRIGVIAQEISKIRPDTVVENNQ 124
           + SD R K N+KP+ N    + Q R ++  K      +  G+IAQEI K+ P+ V  ++ 
Sbjct: 173 MFSDERKKTNIKPITNALDKVLQLRGVTFDKIGDGTRRHAGIIAQEIEKVLPEVVYTDDD 232

Query: 125 GIKSVDYGRL 134
           G+K V YG +
Sbjct: 233 GMKGVAYGNI 242


>gi|160899350|ref|YP_001564932.1| LysR family transcriptional regulator [Delftia acidovorans SPH-1]
 gi|160364934|gb|ABX36547.1| transcriptional regulator, LysR family [Delftia acidovorans SPH-1]
          Length = 300

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 69/143 (48%), Gaps = 18/143 (12%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMG 67
           FHE L     V  P+  +   NP PIA  + A +A+    + L+ ++   +  Y + ++ 
Sbjct: 165 FHEPLVW---VGAPQHEVWRKNPLPIAVYEAASLARTAALSSLAAQRRAHRVVYHSSSLA 221

Query: 68  YQLAPLVSDRRM----KCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
            QLA + S   +    +C+V P   + Q    + P   +   +++ E+S +R     + +
Sbjct: 222 GQLAAVESGLAVAVFTRCSVPPHLQVLQ----NLPAGFELPPLVSMEVSALRS----KAS 273

Query: 124 QGIKSVD--YGRLF-NIGQIQTK 143
           QG  +VD  YG+L   +GQ Q+K
Sbjct: 274 QGSAAVDAMYGQLIATLGQAQSK 296


>gi|149279316|ref|ZP_01885447.1| phage related tail fiber protein [Pedobacter sp. BAL39]
 gi|149229842|gb|EDM35230.1| phage related tail fiber protein [Pedobacter sp. BAL39]
          Length = 827

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 11/69 (15%)

Query: 75  SDRRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SDR +K N+  +          N Y Y++  + +N   IG+IAQEI    P+ V  + +G
Sbjct: 728 SDRSLKTNITRLGKSSEKLETLNGYSYQWKINKRN--DIGMIAQEIKAAFPEAVFTDQKG 785

Query: 126 IKSVDYGRL 134
           I SVDYG+L
Sbjct: 786 ILSVDYGKL 794


>gi|49475688|ref|YP_033729.1| hypothetical protein BH09310 [Bartonella henselae str. Houston-1]
 gi|49238495|emb|CAF27726.1| hypothetical genomic island protein [Bartonella henselae str.
           Houston-1]
          Length = 351

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 9/75 (12%)

Query: 74  VSDRRMKCNVKPVA-----NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN-QGIK 127
           +SDRR K N++         LY+Y Y   P+  +  GV+AQ++ +  P+ V  NN  G+ 
Sbjct: 279 LSDRRAKENIREAGQKKGYTLYEYNYKGSPERYR--GVMAQDVLRSNPEAVFYNNTTGLL 336

Query: 128 SVDYGRL-FNIGQIQ 141
            VDY +L FN+ ++Q
Sbjct: 337 HVDYDKLGFNMERVQ 351


>gi|42523560|ref|NP_968940.1| hypothetical protein Bd2088 [Bdellovibrio bacteriovorus HD100]
 gi|39575766|emb|CAE79933.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio
            bacteriovorus HD100]
          Length = 1258

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 11/71 (15%)

Query: 75   SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
            SDRR K +++ + +            Y ++   +P   Q+IGVIAQE+  + P  V  + 
Sbjct: 1130 SDRRFKTDIEVIPDALNKALQIQGVTYHWKPGVNPDPSQQIGVIAQEVETVFPQAVKTDA 1189

Query: 124  QGIKSVDYGRL 134
             G KSV YG L
Sbjct: 1190 DGYKSVTYGNL 1200


>gi|94967383|ref|YP_589431.1| hypothetical protein Acid345_0352 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549433|gb|ABF39357.1| hypothetical protein Acid345_0352 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 1037

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 13/74 (17%)

Query: 64  VNMGYQLAPLVSDRRMKCNV------------KPVANLYQYRYLSDPKNVQRIGVIAQEI 111
           +N   +L    S RR K N+            +PV   Y+  Y  D  +V++ G+IA+E+
Sbjct: 905 INSTGKLGTTTSSRRFKQNIANIPDSSKLFQLRPVTFFYRPEY-DDGTHVRQYGLIAEEV 963

Query: 112 SKIRPDTVVENNQG 125
           +KI PD VV +NQG
Sbjct: 964 AKIYPDLVVFDNQG 977


>gi|167377044|ref|XP_001734263.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904344|gb|EDR29586.1| hypothetical protein EDI_210610 [Entamoeba dispar SAW760]
          Length = 585

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 12/66 (18%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTV-VENNQ 124
           SD R KC+++P+++           QYRY + P+   R+G +AQE+ +I PD V  +   
Sbjct: 205 SDERTKCHIRPLSDCLESISQLVGKQYRYKNSPQ--LRLGFVAQEVKEILPDLVHTDEIT 262

Query: 125 GIKSVD 130
           G  SVD
Sbjct: 263 GTLSVD 268


>gi|301168297|emb|CBW27887.1| hypothetical protein BMS_3130 [Bacteriovorax marinus SJ]
          Length = 145

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 15/75 (20%)

Query: 75  SDRRMKCNVKPVA---------NLYQYRYLSD--PKNV----QRIGVIAQEISKIRPDTV 119
           SD R K N+ P++         N Y Y Y ++  P+N     ++IGV+AQE+  + P  V
Sbjct: 41  SDVRFKENINPLSDAMKGIASLNAYTYNYKTEEFPENKFSQREQIGVMAQELESVFPQAV 100

Query: 120 VENNQGIKSVDYGRL 134
            E+ +G+K V+Y  L
Sbjct: 101 AEDEKGMKYVNYSML 115


>gi|42523143|ref|NP_968523.1| hypothetical protein Bd1641 [Bdellovibrio bacteriovorus HD100]
 gi|39575348|emb|CAE79516.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 692

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 15/75 (20%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPK----NVQRIGVIAQEISKIRPDTV 119
           SDRR K N+  + +            Y +R    P+    N Q++G+IAQE+  + PD V
Sbjct: 567 SDRRFKRNIATIDSSLEKVLQLRGVTYDWRTDEFPQKNFENGQQVGLIAQEVQSVFPDVV 626

Query: 120 VENNQGIKSVDYGRL 134
            ++N+G  +V Y  L
Sbjct: 627 TKDNEGFLAVQYANL 641


>gi|183232159|ref|XP_653936.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169802174|gb|EAL48549.2| hypothetical protein EHI_105260 [Entamoeba histolytica HM-1:IMSS]
          Length = 675

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 12/66 (18%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTV-VENNQ 124
           SD R KC+++P+++           QYRY + P+   R+G +AQE+ ++ PD V  +   
Sbjct: 295 SDERTKCHIRPLSDCLESISQLVGKQYRYKNSPQ--LRLGFVAQEVKEVLPDLVHTDEIT 352

Query: 125 GIKSVD 130
           G  SVD
Sbjct: 353 GTLSVD 358


>gi|42522678|ref|NP_968058.1| putative YapH protein [Bdellovibrio bacteriovorus HD100]
 gi|39573874|emb|CAE79051.1| putative YapH protein [Bdellovibrio bacteriovorus HD100]
          Length = 1492

 Score = 41.6 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 11/70 (15%)

Query: 75   SDRRMKCNVKPVA---------NLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVVENNQ 124
            SD R+K +++ +          N Y Y Y  +P+N ++ IG+IAQE+ K+ P+ V  +  
Sbjct: 1358 SDARLKTDIQILPDSLNKVLGLNGYSY-YWKNPENKEKQIGLIAQEVEKVFPEAVRTDKD 1416

Query: 125  GIKSVDYGRL 134
            G KSV Y +L
Sbjct: 1417 GSKSVAYQKL 1426


>gi|42522291|ref|NP_967671.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39574822|emb|CAE78664.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1267

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 10/70 (14%)

Query: 75   SDRRMKCNVKPV---------ANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVVENNQ 124
            SDRR+K ++  +          N   Y ++   K  QR +G+IAQE+ K+ P+ V  + +
Sbjct: 1129 SDRRLKRDIATINSALDSILQINGVTYNWIDPSKGDQREVGLIAQEVEKVFPEVVKTDAK 1188

Query: 125  GIKSVDYGRL 134
            G+KSV Y  L
Sbjct: 1189 GLKSVAYQNL 1198


>gi|150396294|ref|YP_001326761.1| hypothetical protein Smed_1074 [Sinorhizobium medicae WSM419]
 gi|150027809|gb|ABR59926.1| hypothetical protein Smed_1074 [Sinorhizobium medicae WSM419]
          Length = 284

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 75  SDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           SDRR+K ++  +A L      Y++RYL   +    +GV+AQE+ ++ P+ VV  + G   
Sbjct: 185 SDRRLKRDIARLAELANGLGVYRFRYLWSDEVF--VGVMAQEVLEVMPEAVVIGSDGYMR 242

Query: 129 VDYGRL 134
           V+Y +L
Sbjct: 243 VNYTKL 248


>gi|149278064|ref|ZP_01884203.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
 gi|149231262|gb|EDM36642.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
          Length = 1026

 Score = 40.8 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 19/78 (24%)

Query: 75  SDRRMKCNVKPVANLYQ---------------YRYLSDPKNVQRIGVIAQEISKIRPDTV 119
           SD R+K N+K +  + Q               ++Y + PK    IGVIAQE+ K+ P+ V
Sbjct: 905 SDERLKTNIKTLTTVLQNLEQMRGVVYEYKDQHKYAAGPK----IGVIAQELRKVYPEMV 960

Query: 120 VENNQGIKSVDYGRLFNI 137
           V    G   VDY +L  +
Sbjct: 961 VMGADGFFKVDYTQLTGV 978


>gi|86360402|ref|YP_472290.1| hypothetical protein RHE_PE00125 [Rhizobium etli CFN 42]
 gi|86284504|gb|ABC93563.1| hypothetical protein RHE_PE00125 [Rhizobium etli CFN 42]
          Length = 217

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 75  SDRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           SDRR+K +++ +        +Y +RY+        +G +AQ++  IRPD + ++  G   
Sbjct: 111 SDRRLKTDIRRLGTSPAGIPIYAFRYIWGGPLF--VGTMAQDLLLIRPDVLSQDATGYYM 168

Query: 129 VDYGRL 134
           VDY RL
Sbjct: 169 VDYARL 174


>gi|316973175|gb|EFV56795.1| NDT80 / PhoG like DNA-binding family protein [Trichinella spiralis]
          Length = 914

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 13/116 (11%)

Query: 24  PISLNNPTPIAPIDYAG---IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
           P+ +    P A +  +G      N+Y    +  K+  KE    VN    L+ L   R ++
Sbjct: 445 PVGVGTDRPTAALTVSGDISCTGNLYHPSDARLKQNIKE----VNCAEALSRLSQIRIVQ 500

Query: 81  CNVKP-VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF 135
             ++P V+  +Q       ++ QR+GVIAQE++ + PD V  N + + +VD  R+F
Sbjct: 501 YEIRPEVSQQWQL----PAEDCQRVGVIAQEVNDVLPDAVKSNGEFL-TVDDSRIF 551


>gi|312088535|ref|XP_003145899.1| hypothetical protein LOAG_10325 [Loa loa]
 gi|307758937|gb|EFO18171.1| hypothetical protein LOAG_10325 [Loa loa]
          Length = 873

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 9/113 (7%)

Query: 25  ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGK--KEFYDAVNMGYQLAPLVSDRRMKCN 82
           +++     +AP+   G   +IY + +  R   +  KE    V+    L+ L   R +  +
Sbjct: 347 VAIGTDRAVAPLTVGG---DIYCSGVVHRPSDRRMKEQIHEVDTKSALSHLAQIRVVGYS 403

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF 135
            KP   L   ++    +N  R+GVIAQE+++I PD V +N   ++ VD  R+F
Sbjct: 404 YKPEIAL---KWGLSEENRHRVGVIAQELAEILPDAVTDNGDFLQ-VDDSRIF 452


>gi|167386204|ref|XP_001737662.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165899432|gb|EDR26021.1| hypothetical protein EDI_013910 [Entamoeba dispar SAW760]
          Length = 619

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SDRR K +VK +++            Y+YL+D K   R G IAQE+ ++ P+ V E+  G
Sbjct: 263 SDRRSKKDVKKISDALNTILMVTGKSYKYLNDDKT--RFGFIAQELKEVIPEAVREDEDG 320

Query: 126 IKSVD 130
             S+D
Sbjct: 321 SLSID 325


>gi|67474538|ref|XP_653018.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56469935|gb|EAL47632.1| hypothetical protein EHI_178450 [Entamoeba histolytica HM-1:IMSS]
          Length = 626

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SDRR K ++K +++            Y+YL+D K   R G IAQE+ ++ P+ V E+  G
Sbjct: 263 SDRRSKKDIKKISDALNTILMITGKSYKYLNDDKT--RFGFIAQELKEVIPEAVREDEDG 320

Query: 126 IKSVD 130
             S+D
Sbjct: 321 SLSID 325


>gi|257462745|ref|ZP_05627153.1| putative YapH protein [Fusobacterium sp. D12]
 gi|317060385|ref|ZP_07924870.1| predicted protein [Fusobacterium sp. D12]
 gi|313686061|gb|EFS22896.1| predicted protein [Fusobacterium sp. D12]
          Length = 542

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 74  VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI 126
           +SD+R+K N++ + N       L  Y +  + +  + +GVIAQE+ K  P+ V E   G 
Sbjct: 453 LSDKRLKQNIEKIQNPLKILKKLNGYTFTMNKE--RHVGVIAQEVQKALPEAVRETENGY 510

Query: 127 KSVDYGRLFNI 137
            SV YG +  +
Sbjct: 511 LSVAYGNMVGL 521


>gi|324500951|gb|ADY40431.1| Myelin gene regulatory factor [Ascaris suum]
          Length = 992

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 38/125 (30%)

Query: 48  NQLSERKEGKKEFYD----AVNMGYQLAPLV--------------SDRRMKCNVKPV--- 86
           + ++ +K G   FY+    A+ M   +APL               SDRR+K  +  V   
Sbjct: 473 SDVAWQKNGSTLFYNSGSVAIGMDRAMAPLTVGGDIYCSGVVHRPSDRRVKEEIHEVDTK 532

Query: 87  ---ANLYQYRYLS-------------DPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
              + L Q R +                +N  R+GVIAQE+++I PD V +N   ++ VD
Sbjct: 533 DAMSRLAQIRVVGYSYKPEIALQWGLSEENRHRVGVIAQELAEILPDAVTDNGDFLQ-VD 591

Query: 131 YGRLF 135
             R+F
Sbjct: 592 DSRIF 596


>gi|183234067|ref|XP_652532.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169801272|gb|EAL47144.2| hypothetical protein EHI_112040 [Entamoeba histolytica HM-1:IMSS]
          Length = 559

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLYQ---------YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD+R K ++K ++N  +         Y+YL+D +  +R G IAQE+ ++ P+ V E+  G
Sbjct: 217 SDQRYKKDIKKISNALEKVLLLTGRSYKYLNDKQ--RRFGFIAQELKEVIPEAVKEDEDG 274

Query: 126 IKSVD 130
             S+D
Sbjct: 275 TLSID 279


>gi|158422473|ref|YP_001523765.1| hypothetical protein AZC_0849 [Azorhizobium caulinodans ORS 571]
 gi|158329362|dbj|BAF86847.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 367

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 74  VSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           +SDRR K ++  V  L      Y++RY   P+    IG++AQ++ K  P+ V +   G  
Sbjct: 293 LSDRRAKEDIAQVGELFDGQPVYRFRYKGAPET--HIGLMAQDVMKAVPEAVGDMG-GFL 349

Query: 128 SVDYG 132
            VDYG
Sbjct: 350 GVDYG 354


>gi|255036291|ref|YP_003086912.1| hypothetical protein Dfer_2529 [Dyadobacter fermentans DSM 18053]
 gi|254949047|gb|ACT93747.1| hypothetical protein Dfer_2529 [Dyadobacter fermentans DSM 18053]
          Length = 456

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 50/89 (56%), Gaps = 11/89 (12%)

Query: 73  LVSDRRMKCNVKPV-ANL--------YQYRYLSDPK-NVQRIGVIAQEISKIRPDTVVEN 122
           L SD+R+K + K + A+L        Y YR+L   +    + G+IAQE+ K+ P+ V  +
Sbjct: 337 LTSDKRLKTDFKNLSASLAKISQLQGYSYRWLDTTRTQTLQTGLIAQEVEKLFPELVNTD 396

Query: 123 NQGIKSVDY-GRLFNIGQIQTKQKKNTAQ 150
           + G KS++Y G + ++ +   + K  TAQ
Sbjct: 397 DNGYKSMNYNGLIPHLIEAVKELKGQTAQ 425


>gi|284035117|ref|YP_003385047.1| hypothetical protein Slin_0183 [Spirosoma linguale DSM 74]
 gi|283814410|gb|ADB36248.1| hypothetical protein Slin_0183 [Spirosoma linguale DSM 74]
          Length = 1168

 Score = 38.5 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 36/75 (48%), Gaps = 15/75 (20%)

Query: 75   SDRRMKCNVK----PVANLYQYRYLSDPKNVQ-----------RIGVIAQEISKIRPDTV 119
            SD R K NV      +A L Q R +S     +           +IG IAQE+ K  P+ V
Sbjct: 1051 SDARFKENVATLNGSLAKLTQLRGVSYTHKAEFIKVRGLSAGKQIGFIAQELEKTFPEFV 1110

Query: 120  VENNQGIKSVDYGRL 134
            V +  G K+VDY RL
Sbjct: 1111 VTSADGYKAVDYARL 1125


>gi|42524641|ref|NP_970021.1| putative cell wall surface anchor family protein [Bdellovibrio
            bacteriovorus HD100]
 gi|39576851|emb|CAE78080.1| putative cell wall surface anchor family protein [Bdellovibrio
            bacteriovorus HD100]
          Length = 1507

 Score = 38.5 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 2/36 (5%)

Query: 96   SDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
            +DP+   ++G IAQE+ K+ P+ V EN +GIK+V Y
Sbjct: 1402 ADPR--LQMGFIAQELEKVYPNVVEENKKGIKAVSY 1435


>gi|325185065|emb|CCA19557.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 965

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 102 QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
           + IG IAQE+ K+ P  V E+ QG K V Y R+  +
Sbjct: 891 REIGFIAQEVEKVLPQVVTEDAQGFKYVAYARIIPV 926


>gi|209548343|ref|YP_002280260.1| hypothetical protein Rleg2_0738 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534099|gb|ACI54034.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 334

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 65/147 (44%), Gaps = 18/147 (12%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAP-IDYAGIAQN-------IYQNQLSE 52
           + ++ Q  +EI +LM    V + P  +N PT   P +D AG+  +       +Y  Q+S+
Sbjct: 189 LTERNQPLNEISALMSGSQVHQ-PSYVNTPTTQLPNVDQAGLINDSFNQKMGLYDRQVSQ 247

Query: 53  RKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGV 106
                   +             SDRR+K +++ V  L      Y ++Y  D    Q IG+
Sbjct: 248 SNAAMGGLFGLGGT-LLGGWAKSDRRLKEDIRRVGTLDNGLPVYAFKY-KDGGPTQ-IGL 304

Query: 107 IAQEISKIRPDTVVENNQGIKSVDYGR 133
           ++ ++ +  PD V E+  G   V Y R
Sbjct: 305 MSDDVRRTHPDAVFEHADGFDRVFYER 331


>gi|163867718|ref|YP_001608920.1| hypothetical protein Btr_0470 [Bartonella tribocorum CIP 105476]
 gi|161017367|emb|CAK00925.1| hypothetical protein BT_0470 [Bartonella tribocorum CIP 105476]
          Length = 351

 Score = 38.1 bits (87), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 74  VSDRRMKCNVKPVA-----NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN-QGIK 127
           +SD R K N+          LY+Y Y   P+  +  GV+AQ++ K +P+ V  NN  G  
Sbjct: 279 LSDTRAKENITEAGQRNGYTLYEYNYKGYPERYR--GVMAQDVLKSKPEAVFYNNATGFL 336

Query: 128 SVDYGRL 134
            VDY +L
Sbjct: 337 HVDYSKL 343


>gi|109290197|ref|YP_656446.1| gp36 small distal tail fiber subunit [Aeromonas phage 25]
 gi|104345870|gb|ABF72770.1| gp36 small distal tail fiber subunit [Aeromonas phage 25]
          Length = 1305

 Score = 38.1 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 10/67 (14%)

Query: 73   LVSDRRMKCNVK----PVANLYQY------RYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
            + SDRR+K N K    P++ + Q       + L D   V  +G+IAQ + K++P +V E 
Sbjct: 1213 VTSDRRLKSNFKAIDNPLSKVEQLTGQIYDKKLKDGGIVSEVGLIAQHVQKVQPMSVREG 1272

Query: 123  NQGIKSV 129
            + G+ S+
Sbjct: 1273 DDGMLSI 1279


>gi|255036788|ref|YP_003087409.1| hypothetical protein Dfer_3029 [Dyadobacter fermentans DSM 18053]
 gi|254949544|gb|ACT94244.1| hypothetical protein Dfer_3029 [Dyadobacter fermentans DSM 18053]
          Length = 323

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 10/67 (14%)

Query: 75  SDRRMKCNVKPV---------ANLYQYRYLSDPKN-VQRIGVIAQEISKIRPDTVVENNQ 124
           SDRR+K ++  +          + Y YR+ S+ ++   + G +AQ++  + P+ V  + Q
Sbjct: 217 SDRRLKSDLTALQGSRHKILGLSGYHYRWASEKRSRALQTGFVAQDVEAVLPELVETDAQ 276

Query: 125 GIKSVDY 131
           G KSV+Y
Sbjct: 277 GYKSVNY 283


>gi|167387265|ref|XP_001738089.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165898835|gb|EDR25599.1| hypothetical protein EDI_172560 [Entamoeba dispar SAW760]
          Length = 567

 Score = 37.7 bits (86), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLYQ---------YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD+R K ++K ++N  +         Y+YL+D +  +R G IAQE+ +I P+ V E+  G
Sbjct: 224 SDQRYKKDIKKISNALEKIMLLTGRSYKYLNDKQ--KRFGFIAQELKEIIPEAVKEDEDG 281

Query: 126 IKSVD 130
             S++
Sbjct: 282 TLSIE 286


>gi|167382030|ref|XP_001735950.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165901856|gb|EDR27843.1| hypothetical protein EDI_154750 [Entamoeba dispar SAW760]
          Length = 603

 Score = 37.7 bits (86), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 10/67 (14%)

Query: 75  SDRRMKCNVKPVAN-------LY--QYRYLSDPKN-VQRIGVIAQEISKIRPDTVVENNQ 124
           SD+R K  ++ + N       LY  +++YL+D +N   R G IAQE+ KI P+ V  + +
Sbjct: 206 SDKRNKKEIEKINNALYGIKHLYGREFKYLTDLENKTPRYGFIAQEVKKIYPELVEIDEE 265

Query: 125 GIKSVDY 131
           G  +VDY
Sbjct: 266 GGLTVDY 272


>gi|67478100|ref|XP_654472.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471518|gb|EAL49082.1| hypothetical protein EHI_006740 [Entamoeba histolytica HM-1:IMSS]
          Length = 692

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R+K N+KP+ +            + Y+   K  +++G IAQE+ K+ P+ V+E+++G
Sbjct: 280 SDIRVKENIKPLVDSLNTVLQLTGTSFNYIG--KKEEKLGFIAQEVKKVCPELVIEDDKG 337

Query: 126 IKSVD 130
             +VD
Sbjct: 338 ELAVD 342


>gi|304413928|ref|ZP_07395345.1| hypothetical protein REG_1014 [Candidatus Regiella insecticola
           LSR1]
 gi|304283648|gb|EFL92043.1| hypothetical protein REG_1014 [Candidatus Regiella insecticola
           LSR1]
          Length = 414

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 47/108 (43%), Gaps = 23/108 (21%)

Query: 48  NQLSERKEGKKEFYDAVNMGYQLAPL-------VSDRRMKCNVKPVANL----------- 89
           N L  RK+G K    A +   + A L        SDRR+K ++KP+  +           
Sbjct: 283 NNLYFRKKGAKNV--AFHFDIETATLRANKFQQASDRRLKTHIKPLGPVLGKILQLQGIY 340

Query: 90  YQYRYLSDPKNVQR---IGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
           Y +   S  K+  +   IG+IA E+    P+ V  +    K VDYGR 
Sbjct: 341 YDWSDHSRTKDYIKEPQIGLIADELQASFPELVACDQDNFKYVDYGRF 388


>gi|148724489|ref|YP_001285455.1| tail fiber [Cyanophage Syn5]
 gi|145588134|gb|ABP87953.1| tail fiber [Synechococcus phage Syn5]
          Length = 1351

 Score = 37.0 bits (84), Expect = 0.83,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 11/73 (15%)

Query: 74   VSDRRMKCNVKPVANL-----------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
            +SD  +K N+ P ++            Y ++  +  +  +++GVIAQ++ +I P  V  +
Sbjct: 1252 LSDINLKENIVPASSQWNNIRDIEIVNYNFKAETGNETNKQLGVIAQQVEEISPGLVNTD 1311

Query: 123  NQGIKSVDYGRLF 135
             +G+KSV+Y  L+
Sbjct: 1312 AEGVKSVNYSVLY 1324


>gi|61805905|ref|YP_214265.1| fiber [Prochlorococcus phage P-SSM2]
 gi|61374414|gb|AAX44411.1| fiber [Prochlorococcus phage P-SSM2]
 gi|265525112|gb|ACY75909.1| predicted protein [Prochlorococcus phage P-SSM2]
          Length = 1908

 Score = 37.0 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 75   SDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKI-RPDTVVEN 122
            SD R+K +VKP+            N + +   S  +  +  GVIAQEIS I  P TV   
Sbjct: 1818 SDARLKNDVKPIQDSLAKVNSISGNTFTWNEASKKEGQEDTGVIAQEISAIGLPGTVTIR 1877

Query: 123  NQGIKSVDYGRL 134
              G  +VDY +L
Sbjct: 1878 EDGTYAVDYEKL 1889


>gi|167380892|ref|XP_001735496.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165902496|gb|EDR28300.1| hypothetical protein EDI_244320 [Entamoeba dispar SAW760]
          Length = 692

 Score = 37.0 bits (84), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R+K N+KP+ +            + Y+   K  +++G IAQE+ K+ P+ V+E+ +G
Sbjct: 280 SDIRVKENIKPLVDSLNTVLQLTGTSFNYIG--KKEEKLGFIAQEVKKVCPELVIEDEKG 337

Query: 126 IKSVD 130
             +VD
Sbjct: 338 ELAVD 342


>gi|255037101|ref|YP_003087722.1| hypothetical protein Dfer_3346 [Dyadobacter fermentans DSM 18053]
 gi|254949857|gb|ACT94557.1| hypothetical protein Dfer_3346 [Dyadobacter fermentans DSM 18053]
          Length = 650

 Score = 37.0 bits (84), Expect = 0.96,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 10/67 (14%)

Query: 75  SDRRMKCNVKPVA---------NLYQYRYLSDPKNVQ-RIGVIAQEISKIRPDTVVENNQ 124
           SDRR+K +  P++         N Y Y +    ++   + G+IAQE+ K+ P+ V  +++
Sbjct: 524 SDRRLKRDFVPLSSSLGKLTSLNGYHYFWKDKERDPSLQTGLIAQEVEKLFPELVKTDSK 583

Query: 125 GIKSVDY 131
           G KS++Y
Sbjct: 584 GFKSLNY 590


>gi|42523988|ref|NP_969368.1| phage related tail fibre protein [Bdellovibrio bacteriovorus HD100]
 gi|39576196|emb|CAE80361.1| phage related tail fibre protein [Bdellovibrio bacteriovorus HD100]
          Length = 1164

 Score = 36.6 bits (83), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 104  IGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            IGVIAQE+ K+ P+ V  +++G K+V Y +L
Sbjct: 1080 IGVIAQEVEKVFPEAVRTDDKGFKAVAYSKL 1110


>gi|312200835|ref|YP_004020896.1| hypothetical protein FraEuI1c_7061 [Frankia sp. EuI1c]
 gi|311232171|gb|ADP85026.1| hypothetical protein FraEuI1c_7061 [Frankia sp. EuI1c]
          Length = 823

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 32/54 (59%)

Query: 95  LSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNT 148
           LS  +  + +G+IAQE+  + P+ V     G++ +DYG+L  +     K++++T
Sbjct: 750 LSGLRGRREVGLIAQEVEAVMPELVGVGADGVRGIDYGKLTAVLVQAIKEQQST 803


>gi|42523208|ref|NP_968588.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39575413|emb|CAE79581.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1365

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 23/32 (71%)

Query: 103  RIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            ++G IAQE+ KI P+ V  + QG+KSV+Y  L
Sbjct: 1273 QLGFIAQELEKIYPELVETDPQGMKSVNYSHL 1304


>gi|67477509|ref|XP_654215.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471246|gb|EAL48829.1| hypothetical protein EHI_122890 [Entamoeba histolytica HM-1:IMSS]
          Length = 612

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 91  QYRYLSDPKN-VQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           +++YL DP++  +R G IAQE+ +I P+ V  + +G  +VDY
Sbjct: 241 EFKYLRDPEDKARRYGFIAQEVKEIYPELVQIDEEGGLTVDY 282


>gi|34419532|ref|NP_899545.1| long tail fiber distal subunit [Vibrio phage KVP40]
 gi|34333213|gb|AAQ64368.1| long tail fiber distal subunit [Vibrio phage KVP40]
          Length = 1094

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 47/88 (53%), Gaps = 13/88 (14%)

Query: 75   SDRRMKCNVKPVAN-------LYQYRY-LSDPKNVQRIGVIAQEISKIRPDTVVENN--- 123
            SD R+K NV+ + N       L  Y Y  +D +  ++ GVIAQE+ ++ P+ VVE+    
Sbjct: 994  SDARVKTNVERITNPLEKIDRLNGYTYDRTDVECPRQTGVIAQEVLEVLPEAVVESGGDA 1053

Query: 124  QGIKSVDYGRLFN--IGQIQTKQKKNTA 149
             G  +V YG +    I  I+ +++K  A
Sbjct: 1054 DGHYAVAYGNMVGLLIEGIKEEKRKREA 1081


>gi|183230818|ref|XP_654628.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169802761|gb|EAL49242.2| hypothetical protein EHI_142010 [Entamoeba histolytica HM-1:IMSS]
          Length = 679

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 10/85 (11%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R K +++ + N            Y Y +D  N ++ G +AQ++ KI PD V E++ G
Sbjct: 237 SDARSKTDIEEIHNSLNGILSLVGVSYSYKNDSDN-KKYGFVAQDVQKIYPDLVKEDDTG 295

Query: 126 IKSVDYGRLFNIGQIQTKQKKNTAQ 150
             +VDY  +  +     K+  N AQ
Sbjct: 296 KLTVDYLGIIPLLVEALKEIHNNAQ 320


>gi|319409246|emb|CBI82890.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 374

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 74  VSDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-VENNQGIK 127
           +SD R+K N+  V       LY++ Y  DP+  +  GV+AQ++ +++PD V +++   + 
Sbjct: 276 LSDARVKDNIVSVGEKNGYPLYEFNYKGDPQRYR--GVMAQDLVRLKPDAVHMDDKTQLL 333

Query: 128 SVDYGRL 134
            VDY ++
Sbjct: 334 YVDYDKI 340


>gi|27380286|ref|NP_771815.1| hypothetical protein bll5175 [Bradyrhizobium japonicum USDA 110]
 gi|27353450|dbj|BAC50440.1| bll5175 [Bradyrhizobium japonicum USDA 110]
          Length = 552

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 92  YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
           YR+  +  +   +GVIAQE+  +RPD V   + G   V Y RL
Sbjct: 485 YRFAYNGSDKAYVGVIAQEVQTVRPDAVTRGSDGNLRVYYERL 527


>gi|298713329|emb|CBJ33556.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 759

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 105 GVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
           G IAQE+ ++ P+ V E++ G K+V Y RL
Sbjct: 585 GFIAQEVEQVAPEVVAEDSNGYKTVAYSRL 614


>gi|167379710|ref|XP_001735250.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165902849|gb|EDR28569.1| hypothetical protein EDI_338220 [Entamoeba dispar SAW760]
          Length = 679

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 10/85 (11%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R K +++ + N            Y Y  D  N ++ G IAQE+ KI P+ V E++ G
Sbjct: 237 SDARSKTDIEEIHNSLNGILSLVGVSYSYKKDCDN-KKYGFIAQEVQKIYPELVKEDDTG 295

Query: 126 IKSVDYGRLFNIGQIQTKQKKNTAQ 150
             +VDY  +  +     K+  N AQ
Sbjct: 296 KLTVDYLGIIPLLVEALKEIHNNAQ 320


>gi|240850570|ref|YP_002971970.1| hypothetical protein Bgr_10160 [Bartonella grahamii as4aup]
 gi|240267693|gb|ACS51281.1| hypothetical protein Bgr_10160 [Bartonella grahamii as4aup]
          Length = 351

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 9/75 (12%)

Query: 74  VSDRRMKCNVKPVA-----NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-VENNQGIK 127
           +SD R K N+  V       LY+Y Y   P+  +  GV+AQ++ K +P+ V +    G  
Sbjct: 279 LSDIRAKENIVQVGQRDGHKLYEYNYKGYPERYR--GVMAQDVLKSKPEAVFLHKATGFL 336

Query: 128 SVDYGRL-FNIGQIQ 141
            VDYG+L F + ++Q
Sbjct: 337 HVDYGKLGFEMERVQ 351


>gi|313675512|ref|YP_004053508.1| hypothetical protein Ftrac_1410 [Marivirga tractuosa DSM 4126]
 gi|312942210|gb|ADR21400.1| hypothetical protein Ftrac_1410 [Marivirga tractuosa DSM 4126]
          Length = 659

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 10/69 (14%)

Query: 76  DRRMKCNVKPVANLY---------QYRYLSDPKNVQR-IGVIAQEISKIRPDTVVENNQG 125
           DRR+K N+  + N            Y + ++  + +R IG+IAQE+ ++ P+ V  + +G
Sbjct: 536 DRRLKKNISTLENSLANTLRLRGTTYYWKNENSSTERQIGLIAQEVEEVYPEFVHTDAEG 595

Query: 126 IKSVDYGRL 134
            KSV+Y ++
Sbjct: 596 KKSVNYSQM 604


>gi|294084056|ref|YP_003550814.1| 5-oxoprolinase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663629|gb|ADE38730.1| 5-oxoprolinase (ATP-hydrolyzing) [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 1221

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 50/113 (44%), Gaps = 9/113 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGK------KEFYDAVNMGYQLAPLVSD 76
           L I  N+P P + ID   +   +  N L ERK  +      K F D + + YQ  P + D
Sbjct: 68  LNIESNDPIPASLIDAVKMGTTVATNALLERKGDRTLLVVTKGFRDQIRIAYQARPRLFD 127

Query: 77  RRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
           R++     P     +   +++  + +   ++  ++  +RP      + GI+S+
Sbjct: 128 RKITL---PEMLYERVEEVNERIDAEDNVLVPLDLDDLRPRLQAAYDDGIRSI 177


>gi|240851418|ref|YP_002972497.1| putative phage related protein [Bartonella grahamii as4aup]
 gi|240268541|gb|ACS52129.1| putative phage related protein [Bartonella grahamii as4aup]
          Length = 379

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 8/65 (12%)

Query: 76  DRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG-IKSV 129
           D R K N+ PV       LY + Y  +P+  Q  GV+AQ++ +++P+ V  N +  +  V
Sbjct: 278 DVRAKENIIPVGQKKGYPLYTFNYKGNPQRYQ--GVMAQDVLRVKPEAVYVNAKTKLLHV 335

Query: 130 DYGRL 134
           DYG++
Sbjct: 336 DYGKI 340


>gi|257453322|ref|ZP_05618621.1| hypothetical protein F3_09692 [Fusobacterium sp. 3_1_5R]
 gi|317059853|ref|ZP_07924338.1| predicted protein [Fusobacterium sp. 3_1_5R]
 gi|313685529|gb|EFS22364.1| predicted protein [Fusobacterium sp. 3_1_5R]
          Length = 66

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 105 GVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
           GVIAQE+ KI P  V   NQG KSVDY  L  +
Sbjct: 11  GVIAQEVEKILPQAV--QNQGYKSVDYNALVGL 41


>gi|49476061|ref|YP_034102.1| hypothetical protein BH13970 [Bartonella henselae str. Houston-1]
 gi|49238869|emb|CAF28162.1| hypothetical protein BH13970 [Bartonella henselae str. Houston-1]
          Length = 374

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 8/65 (12%)

Query: 76  DRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG-IKSV 129
           D R K N+ PV       LY + Y  DP+  +  GV+AQE+ +++P+ V  N +  +  V
Sbjct: 278 DVRAKENIVPVGEKNGYPLYVFNYKGDPQ--RYCGVLAQEVLRLKPEAVFVNAKTKLLHV 335

Query: 130 DYGRL 134
           DY ++
Sbjct: 336 DYNKI 340


>gi|170581054|ref|XP_001895519.1| hypothetical protein [Brugia malayi]
 gi|158597502|gb|EDP35634.1| conserved hypothetical protein [Brugia malayi]
          Length = 487

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/37 (45%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 99  KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF 135
           +N  R+GVIAQE+++I PD V +N   ++ VD  R+F
Sbjct: 40  ENRHRVGVIAQELAEILPDAVTDNGDYLQ-VDDSRIF 75


>gi|167376221|ref|XP_001733910.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904804|gb|EDR29951.1| hypothetical protein EDI_007940 [Entamoeba dispar SAW760]
          Length = 298

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R K +++ + N            Y Y  D  N ++ G IAQE+ KI P+ V E++ G
Sbjct: 231 SDARSKTDIEEIHNSLNGILSLVGVSYSYKKDCDN-KKYGFIAQEVQKIYPELVKEDDTG 289

Query: 126 IKSVDY 131
             +VDY
Sbjct: 290 KLTVDY 295


>gi|113476455|ref|YP_722516.1| peptidyl-tRNA hydrolase [Trichodesmium erythraeum IMS101]
 gi|119391035|sp|Q110N1|PTH_TRIEI RecName: Full=Peptidyl-tRNA hydrolase; Short=PTH
 gi|110167503|gb|ABG52043.1| peptidyl-tRNA hydrolase [Trichodesmium erythraeum IMS101]
          Length = 219

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 38/86 (44%), Gaps = 11/86 (12%)

Query: 17 NVTVPKLPISLNNPTPIAP-----IDYAGI--AQNIYQNQLSERKEGKKEFYDA----VN 65
          N+ +PKL + L NP P        I + GI    NI+Q  LSE ++ K EF +       
Sbjct: 9  NLVIPKLIVGLGNPEPKYDQTRHNIGFTGIDTIANIWQVSLSENRKFKGEFGEGRRPKAE 68

Query: 66 MGYQLAPLVSDRRMKCNVKPVANLYQ 91
            Y L PL    R    +  V N Y+
Sbjct: 69 KIYLLKPLTYMNRSGEAISAVVNWYK 94


>gi|67477000|ref|XP_654021.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471036|gb|EAL48635.1| hypothetical protein EHI_064510 [Entamoeba histolytica HM-1:IMSS]
          Length = 524

 Score = 35.0 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 75  SDRRMKCNVKPVANLYQY-------RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           SD R K  + P+ N  +         Y  D  N +  G IAQE+ +  PD V E+  G  
Sbjct: 201 SDSRTKTKIAPIRNALERLLNVTGKMYTYDVANAETYGFIAQELKEHFPDLVHEDESGYL 260

Query: 128 SVD 130
           S+D
Sbjct: 261 SID 263


>gi|167396330|ref|XP_001742013.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165893164|gb|EDR21505.1| hypothetical protein EDI_049010 [Entamoeba dispar SAW760]
          Length = 411

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R K +++ + N           +Y Y ++P  + + G IAQE+ ++ PD V ++  G
Sbjct: 269 SDARSKTDIQTIENALNSVTSLVGKKYAYKNEPNKI-KYGFIAQEVQEVIPDLVQKDESG 327

Query: 126 IKSVDY 131
             SVDY
Sbjct: 328 NLSVDY 333


>gi|124010598|ref|ZP_01695214.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
 gi|123982213|gb|EAY23814.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
          Length = 369

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 16/75 (21%)

Query: 73  LVSDRRMKCNVKP-----VANLYQ-----YRYLSDPKNVQR------IGVIAQEISKIRP 116
           L SD R K N++P     VA L Q     Y++ ++    +R      +G+IAQE++++ P
Sbjct: 209 LTSDIRYKKNIQPLSTDVVAKLSQVRGTSYKFRTEEFKEKRFLKTKQVGIIAQELAQVYP 268

Query: 117 DTVVENNQGIKSVDY 131
           + V++   G  SV+Y
Sbjct: 269 ELVMKGADGYYSVNY 283


>gi|311993249|ref|YP_004010115.1| gp37 long tail fiber, distal subunit [Enterobacteria phage CC31]
 gi|284178087|gb|ADB81753.1| gp37 long tail fiber, distal subunit [Enterobacteria phage CC31]
          Length = 870

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 13/85 (15%)

Query: 73  LVSDRRMKCNVKPV----ANLYQY---RY-LSDPKNVQRIGVIAQEISKIRPDTVVEN-N 123
           L SD  +K +++ +    +NL++    RY + D  N   IGVIAQE+ ++ P+ V EN +
Sbjct: 769 LTSDISLKKDIRSIEDSRSNLHKVEIKRYAMKDGSNDNAIGVIAQEVQEVYPELVNENKD 828

Query: 124 QGIKSVDY----GRLFNIGQIQTKQ 144
            G  SV+Y      L+ I Q Q K+
Sbjct: 829 TGKLSVNYRGLSSVLWKIVQEQDKE 853


>gi|148244250|ref|YP_001218944.1| DNA polymerase I [Candidatus Vesicomyosocius okutanii HA]
 gi|146326077|dbj|BAF61220.1| DNA polymerase I [Candidatus Vesicomyosocius okutanii HA]
          Length = 909

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---KPV------A 87
           D  GI +N  Q +  +  E  ++ +D +++ YQL  L  D  + CN+   +PV      A
Sbjct: 207 DILGIKENAMQIK-GKVGEKLRDNFDLLDLSYQLVKLKFDVVLPCNILDDEPVKNIDKLA 265

Query: 88  NLY-QYRYLSDPKNVQRIGVIAQE-ISKIRPDTVVENNQGI 126
           NLY QY +    K +  + V+ Q+ I  I  DT V N+  I
Sbjct: 266 NLYQQYGFFMWLKQLDNVSVLKQKSIQVIGTDTGVNNSVDI 306


>gi|94967385|ref|YP_589433.1| hypothetical protein Acid345_0354 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549435|gb|ABF39359.1| hypothetical protein Acid345_0354 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 689

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 74  VSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           + D R    ++PV   Y+  Y       Q  G+IA+E++KI PD V+ + +G
Sbjct: 572 IGDSRKLFQLRPVTFFYKPEYDGGAHEKQ-FGLIAEEVAKIYPDMVINDKEG 622


>gi|27378597|ref|NP_770126.1| hypothetical protein blr3486 [Bradyrhizobium japonicum USDA 110]
 gi|27351745|dbj|BAC48751.1| blr3486 [Bradyrhizobium japonicum USDA 110]
          Length = 558

 Score = 34.7 bits (78), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 90  YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
           Y++ YL   K    +GV+AQE+ +++P+ V   N G   V Y +L
Sbjct: 493 YRFSYLGSHK--AYVGVMAQEVERVKPEAVTRGNDGYLLVHYDKL 535


>gi|124002007|ref|ZP_01686861.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
 gi|123992473|gb|EAY31818.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
          Length = 609

 Score = 34.7 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 73  LVSDRRMKCNVKPV------------ANLYQYRYLS----DPKNVQRIGVIAQEISKIRP 116
           L SD R K ++ P+             N YQ+R       D     ++G IAQE+ ++ P
Sbjct: 485 LTSDIRFKKDIMPITHEVIAKLGQLQGNTYQWRTEEFKNRDFAEGTQLGFIAQEMQEVYP 544

Query: 117 DTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           + V E++QG  S++Y  L  +     K   N ++
Sbjct: 545 ELVNEDHQGDLSINYTGLIPVLTEALKDLNNKSE 578


>gi|319405790|emb|CBI79416.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 343

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 74  VSDRRMKCNVKPVA-----NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN-QGIK 127
           +SD R K N+  V       LY Y Y   P+  +  GVIAQE+ +  P+ V  N   G  
Sbjct: 271 LSDVRAKENIIAVGQKNGHKLYDYNYKGYPERYR--GVIAQEVFQANPEAVFLNTATGFL 328

Query: 128 SVDYGRL 134
            VDY +L
Sbjct: 329 HVDYNKL 335


>gi|241667087|ref|YP_002985171.1| hypothetical protein Rleg_7204 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862544|gb|ACS60209.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 224

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 76  DRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
           DRR+K  V+ +        +Y +RY+        IG +AQ++   RPD V++   G   V
Sbjct: 111 DRRLKTQVRRIGTSPSGIPVYAFRYIWGGPLF--IGTMAQDLLLTRPDAVLQTASGYYMV 168

Query: 130 DYGRL 134
            Y +L
Sbjct: 169 SYEKL 173


>gi|307105763|gb|EFN54011.1| hypothetical protein CHLNCDRAFT_58365 [Chlorella variabilis]
          Length = 1346

 Score = 34.7 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 17/80 (21%)

Query: 72  PLVSDRRMKCNVKP----------VANLYQYRYLSDPKNVQRIGVIAQEISKIRP----- 116
           P+VSD  MK  V+            A +  Y Y     + QR+GV+AQ++  +       
Sbjct: 387 PVVSDASMKEGVRAFEQGEKAVAIAAEITTYLYRYKGTDAQRLGVVAQQVRAVLEQHGAT 446

Query: 117 --DTVVENNQGIKSVDYGRL 134
             + V ++ QG  SVDYG L
Sbjct: 447 DMNLVRQDPQGALSVDYGGL 466


>gi|33864296|ref|NP_895856.1| phosphoribose diphosphate:decaprenyl-phosphate
           phosphoribosyltransferase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33641076|emb|CAE22205.1| UbiA prenyltransferase [Prochlorococcus marinus str. MIT 9313]
          Length = 306

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 32/51 (62%)

Query: 86  VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFN 136
           +  +++Y+ LSDP+ V+R G +  +++  +P+ ++ N++GI+    G +  
Sbjct: 244 LVGIFRYQLLSDPEEVERRGTLRPDLNGEKPEEILLNDRGIQFTLIGWVLT 294


>gi|67477993|ref|XP_654427.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471466|gb|EAL49035.1| hypothetical protein EHI_083660 [Entamoeba histolytica HM-1:IMSS]
          Length = 698

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R K +++ + N           +Y Y ++P  + + G IAQE+ ++ PD V ++  G
Sbjct: 269 SDARSKTDIQTIENALNSVTSLVGKKYAYKNEPNKI-KYGFIAQEVQEVIPDLVQKDESG 327

Query: 126 IKSVDY 131
             SVDY
Sbjct: 328 NLSVDY 333


>gi|313157451|gb|EFR56872.1| conserved hypothetical protein [Alistipes sp. HGB5]
          Length = 221

 Score = 33.9 bits (76), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 14/110 (12%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNV 101
           A+N+Y N  +  K   +    A     QL P+  +   K +    +     R  +   N 
Sbjct: 105 ARNVYTNSDAASKTNIQSLGSATATLTQLRPVSFEWADKAHYFKTS-----RRSTGVSNP 159

Query: 102 QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI---------GQIQT 142
           + +G IAQEI ++ PD V  + +G + V+Y  L  +         GQI+T
Sbjct: 160 KEMGFIAQEIEQVLPDIVAVDCEGHRVVNYSALIPLLTKSIQELNGQIET 209


>gi|167394032|ref|XP_001740814.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165894905|gb|EDR22737.1| hypothetical protein EDI_336360 [Entamoeba dispar SAW760]
          Length = 524

 Score = 33.9 bits (76), Expect = 7.2,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 75  SDRRMKCNVKPVANLYQY-------RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           SD R K  V P+ N  +         Y  D  + +  G IAQE+ +  PD V E+  G  
Sbjct: 201 SDSRTKTKVAPIRNALERLLNVTGKMYTYDVADAETYGFIAQELKEQFPDLVHEDESGYL 260

Query: 128 SVD 130
           S+D
Sbjct: 261 SID 263


>gi|291514530|emb|CBK63740.1| hypothetical protein AL1_12670 [Alistipes shahii WAL 8301]
          Length = 174

 Score = 33.9 bits (76), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 14/110 (12%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNV 101
           A+N+Y N  +  K   +    A     QL P+  +   K +    +     R  +   N 
Sbjct: 58  ARNVYTNSDAASKTNIQSLGSATATLTQLRPVSFEWADKAHYFKTS-----RRSTGVSNP 112

Query: 102 QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI---------GQIQT 142
           + +G IAQEI ++ PD V  + +G + V+Y  L  +         GQI+T
Sbjct: 113 KEMGFIAQEIEQVLPDIVAVDCEGHRVVNYSALIPLLTKSIQELNGQIET 162


>gi|308509976|ref|XP_003117171.1| CRE-PQN-47 protein [Caenorhabditis remanei]
 gi|308242085|gb|EFO86037.1| CRE-PQN-47 protein [Caenorhabditis remanei]
          Length = 932

 Score = 33.9 bits (76), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 8/91 (8%)

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISK 113
           KEG  E   A  +   L   V D R K  V  V  L       D +  QR G+IAQE+  
Sbjct: 479 KEGISEKETAEAIENLLKLRVVDYRYKSEVADVWGL-------DEQQRQRTGLIAQELQA 531

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQIQTKQ 144
           + PD V +    + ++D GR+F    + T+Q
Sbjct: 532 VLPDAVRDIGDYL-TIDEGRVFYETVMATQQ 561


>gi|167377056|ref|XP_001734269.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904350|gb|EDR29592.1| hypothetical protein EDI_210770 [Entamoeba dispar SAW760]
          Length = 674

 Score = 33.5 bits (75), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 10/66 (15%)

Query: 75  SDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD R K +++ + N           +Y Y ++P  V + G IAQE+ K+ P+ V +++ G
Sbjct: 245 SDVRSKTDIQIIENALNSILSLVGKKYSYKNEPNKV-KYGFIAQEVQKVIPNLVQKDDTG 303

Query: 126 IKSVDY 131
             SVDY
Sbjct: 304 NLSVDY 309


>gi|121602136|ref|YP_988568.1| hypothetical protein BARBAKC583_0235 [Bartonella bacilliformis
           KC583]
 gi|120614313|gb|ABM44914.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 392

 Score = 33.5 bits (75), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 9/52 (17%)

Query: 74  VSDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRI-GVIAQEISKIRPDTV 119
           +SD RMK N+ P+       LY++ Y       QR  GVIAQ++ ++ PD V
Sbjct: 277 LSDVRMKDNIVPIGQKNGYPLYEFNY---KGGAQRYRGVIAQDVLRLNPDAV 325


>gi|49474618|ref|YP_032660.1| hypothetical protein BQ11070 [Bartonella quintana str. Toulouse]
 gi|49240122|emb|CAF26568.1| hypothetical protein BQ11070 [Bartonella quintana str. Toulouse]
          Length = 374

 Score = 33.5 bits (75), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 8/63 (12%)

Query: 75  SDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG-IKS 128
           SD R K N+ P+       +Y + Y  DP+  +  GVIAQ++ +++PD V  N +  +  
Sbjct: 277 SDLRAKENIVPIGEKNGYPIYIFNYKGDPQLYR--GVIAQDVLRLKPDAVYINAKTKLLH 334

Query: 129 VDY 131
           VDY
Sbjct: 335 VDY 337


>gi|327440160|dbj|BAK16525.1| diaminopimelate epimerase [Solibacillus silvestris StLB046]
          Length = 320

 Score = 33.5 bits (75), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           ++ +QQ  HEI+    ++ +P   IS+ NP  I  +D+  +   ++Q QL+     + E+
Sbjct: 135 VENRQQLRHEIIPAF-SMDIPFTAISVPNPHLIGIVDHKYMENTLHQEQLAAYLNSENEY 193

Query: 61  Y-DAVNMGYQLAPLVSDR 77
             D VN+ Y + PL  D 
Sbjct: 194 CPDGVNVSY-VQPLSPDE 210


Searching..................................................done


Results from round 2




>gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040808|gb|ACT57604.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 150

 Score =  204 bits (519), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 150/150 (100%), Positives = 150/150 (100%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF
Sbjct: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
           YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV
Sbjct: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120

Query: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ
Sbjct: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150


>gi|315122526|ref|YP_004063015.1| hypothetical protein CKC_03890 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495928|gb|ADR52527.1| hypothetical protein CKC_03890 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 389

 Score =  183 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 87/146 (59%), Positives = 113/146 (77%), Gaps = 1/146 (0%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +DQKQQA HEILSLMQ +   K PI+ NNP  I P+DY  I+QN YQN+  E K+ K+  
Sbjct: 244 IDQKQQALHEILSLMQTIPASKFPITQNNPIAITPVDYREISQNDYQNRFQEWKQRKQNI 303

Query: 61  YDAVNMGYQL-APLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
           YD++N+G +L   ++SDRRMK ++KPV NLYQYRY+SDPK  QRIGV+AQEI+KIRPD V
Sbjct: 304 YDSINIGNKLVGSILSDRRMKRDIKPVGNLYQYRYVSDPKRTQRIGVMAQEINKIRPDAV 363

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQK 145
           V+N+QG++SVDYG LFN  +I + +K
Sbjct: 364 VKNSQGLQSVDYGLLFNTSKILSPRK 389


>gi|327191473|gb|EGE58493.1| hypothetical protein RHECNPAF_300003 [Rhizobium etli CNPAF512]
          Length = 335

 Score =  167 bits (422), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 61/147 (41%), Gaps = 15/147 (10%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNI-------YQNQLSER 53
           + ++ Q  +EI +LM    V +        T +  +D AG+           Y  Q+++ 
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPNYVNTPTTQLPNVDQAGLINENFNQKMGLYDRQVAQS 248

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVI 107
                  +   +       + SDRR+K ++K V  L      Y +RY        ++G++
Sbjct: 249 NAAMGGLFGLGSSLLGGWAMKSDRRLKEDIKRVGTLENGLPVYAFRYK--EGGPMQLGLM 306

Query: 108 AQEISKIRPDTVVENNQGIKSVDYGRL 134
           + ++ K  PD V E+  G   VDY R 
Sbjct: 307 SDDVRKTHPDAVFEHADGFDRVDYERA 333


>gi|227822435|ref|YP_002826407.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234]
 gi|227341436|gb|ACP25654.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234]
          Length = 453

 Score =  162 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 48/145 (33%), Positives = 74/145 (51%), Gaps = 10/145 (6%)

Query: 4   KQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDA 63
           + Q  +EI +L+    V            I P+DYAG+ Q  YQNQ++     ++   + 
Sbjct: 306 RNQPINEISALLSGAQVTTPNFVPTQGQSIQPVDYAGLVQQNYQNQMAAYNARQQSGGNL 365

Query: 64  VN---MGYQLAPLVSDRRMKCNVKPVA-----NLYQYRYLSD-PKNVQRIGVIAQEISKI 114
           +      ++  PL SDRR K N++ V      NLY++ Y  +     + IGV+AQE+ + 
Sbjct: 366 LGNVLGMFEKIPL-SDRRAKKNIEKVGRLKAHNLYEFDYKGEQAGGPKHIGVMAQEVERT 424

Query: 115 RPDTVVENNQGIKSVDYGRLFNIGQ 139
           RPD V+    G++ VDYGRLF  G 
Sbjct: 425 RPDAVIRGPDGMRRVDYGRLFAAGH 449


>gi|218673260|ref|ZP_03522929.1| hypothetical protein RetlG_17541 [Rhizobium etli GR56]
          Length = 334

 Score =  160 bits (405), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 35/149 (23%), Positives = 61/149 (40%), Gaps = 16/149 (10%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNI-------YQNQLSER 53
           + ++ Q  +EI +LM    V +        T +  +D AG+           Y  Q+++ 
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPNYVNTPTTQLPNVDQAGLINENFNQKMGLYDRQVAQS 248

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVI 107
                  +   +         SDRR+K ++K V  L      Y +RY        ++G++
Sbjct: 249 NAAMGGLFGLGSSLLG-GWAKSDRRLKEDIKRVGTLENGLPVYAFRYK--EGGPMQLGLM 305

Query: 108 AQEISKIRPDTVVENNQGIKSVDYGRLFN 136
           + ++ K  PD VVE+  G   VDY R   
Sbjct: 306 SDDVRKTHPDAVVEHADGFDRVDYERAVA 334


>gi|116253668|ref|YP_769506.1| hypothetical protein RL3928 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258316|emb|CAK09418.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 335

 Score =  157 bits (397), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 62/147 (42%), Gaps = 15/147 (10%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSER------- 53
           + ++ Q  +EI +LM    V +        T +  +D AG+    Y  Q+          
Sbjct: 189 LTERNQPLNEISALMSGSQVNQPNYVNAPTTQLPTVDQAGLINENYNQQMGAYNSQVSKS 248

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVI 107
                  +   +       + SDRR+K ++K V  L      Y +RY        +IG++
Sbjct: 249 NAAMGGLFGLGSSLLGGWAMGSDRRLKEDIKRVGTLDNGLPVYVFRYK--KGGPTQIGLM 306

Query: 108 AQEISKIRPDTVVENNQGIKSVDYGRL 134
           + ++ ++ P++V E+ +G   VDY + 
Sbjct: 307 SDDVREVHPESVFEDAEGFDRVDYEKA 333


>gi|110632598|ref|YP_672806.1| hypothetical protein Meso_0237 [Mesorhizobium sp. BNC1]
 gi|110283582|gb|ABG61641.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 322

 Score =  157 bits (397), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 41/142 (28%), Positives = 66/142 (46%), Gaps = 13/142 (9%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLP--ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK 58
           + Q+ Q  +EI+ LM    V       +    + +A +DY G+    YQ  ++  + G  
Sbjct: 185 LAQRNQPLNEIIGLMSGTQVQNPNATFAQTPQSGVAGVDYTGLVNQKYQADVANYRAGMG 244

Query: 59  EFYDAVNMGYQLAPLVSDRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEIS 112
             +   +    L P  SD R+K +++ V        +Y +RY  DP  V  IGV+AQE+ 
Sbjct: 245 GLFGLGSALIGLLP-SSDERLKSDIRRVGTTDGGVPIYIFRYRDDPFKVWHIGVMAQEV- 302

Query: 113 KIRPDTVVENNQGIKSVDYGRL 134
              P+  V +  G   VDYGR+
Sbjct: 303 ---PEARVSDESGFFRVDYGRV 321


>gi|150397020|ref|YP_001327487.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419]
 gi|150028535|gb|ABR60652.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419]
          Length = 532

 Score =  151 bits (381), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/142 (33%), Positives = 76/142 (53%), Gaps = 4/142 (2%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q+ Q  +EI+ LM    V           P+  +DYAG+ Q  Y N++   ++ +    
Sbjct: 389 AQRNQPINEIVGLMSGAQVDSPSFVPTQSNPMPTVDYAGLVQQDYANKMGAYQQKQSTMQ 448

Query: 62  D---AVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKN-VQRIGVIAQEISKIRPD 117
           +    +         +SD+R K ++K V  LY+YRY  + +N  +RIGV+AQE+ K+RPD
Sbjct: 449 NLFGGMLGFGGQLASLSDKRAKKDIKKVGGLYEYRYKGEGRNAPKRIGVMAQEVEKVRPD 508

Query: 118 TVVENNQGIKSVDYGRLFNIGQ 139
            V +   G++ VDYG LFN G+
Sbjct: 509 AVAKGADGLRRVDYGLLFNAGR 530


>gi|13470675|ref|NP_102244.1| hypothetical protein mll0449 [Mesorhizobium loti MAFF303099]
 gi|14021417|dbj|BAB48030.1| mll0449 [Mesorhizobium loti MAFF303099]
          Length = 230

 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 62/145 (42%), Gaps = 10/145 (6%)

Query: 4   KQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDA 63
           + Q  +EI +L+    V     +   P+ I   D AGI  N YQ ++        +    
Sbjct: 85  RNQPINEITALLSGSQVSNPQAAAYTPSTIPTTDNAGIIANNYQQKMDAYNAQMSQASSL 144

Query: 64  VNMGYQLA---------PLVSDRRMKCNVKPVANLYQYRYLSDPKN-VQRIGVIAQEISK 113
               + L              D+    ++ P   L+++ Y  +P +   R+G++A E+ K
Sbjct: 145 AGGLFGLGGKLISLSDDDAKKDKERLADITPEMGLWKFHYKGEPADAPMRLGLMASEVEK 204

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIG 138
           +RPD V     G + VDYG+  ++G
Sbjct: 205 VRPDAVSRRPDGYRQVDYGKALSLG 229


>gi|316933872|ref|YP_004108854.1| hypothetical protein Rpdx1_2530 [Rhodopseudomonas palustris DX-1]
 gi|315601586|gb|ADU44121.1| hypothetical protein Rpdx1_2530 [Rhodopseudomonas palustris DX-1]
          Length = 341

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/154 (25%), Positives = 62/154 (40%), Gaps = 20/154 (12%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSER-------K 54
            ++    +EI +L+    V     S    T +A  DYAG+  N Y  Q+           
Sbjct: 189 AERNAPINEITALLSGSQVSAPNYSSTPTTGVAGTDYAGMVSNNYGQQMQAYNNKLQSNN 248

Query: 55  EGKKEFYDAVNM----GYQLAP---LVSDRRMKCNV----KPVANLYQYRYLSDPKNVQR 103
                 +         G +  P    +SDRR+K ++    +  A L  Y Y    +  + 
Sbjct: 249 AAMGGMFGLAGTLGAAGMKYGPTWMAMSDRRLKSDIVDTGETFAGLPVYEYTIFGR--RE 306

Query: 104 IGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
            GV+A E+ ++ P+ V  +  G K VDYGRL   
Sbjct: 307 RGVMADEVEQVMPEAVALHPSGFKMVDYGRLQGA 340


>gi|86356745|ref|YP_468637.1| hypothetical protein RHE_CH01103 [Rhizobium etli CFN 42]
 gi|86280847|gb|ABC89910.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 334

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 59/149 (39%), Gaps = 16/149 (10%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNI-------YQNQLSER 53
           + ++ Q  +EI +LM    V +        T +  +D AG+           Y  QL++ 
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPNYVNTPTTQLPTVDQAGLINENFNQKMGIYNQQLAQS 248

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVI 107
                  +             SDRR+K ++K V  L      Y +RY        ++G++
Sbjct: 249 NAAMGGLFGLGGTLLGGWA-KSDRRLKQDIKRVGTLENGLPVYAFRYK--EGGPMQLGLM 305

Query: 108 AQEISKIRPDTVVENNQGIKSVDYGRLFN 136
           + ++ +I PD V E+  G   VD  R   
Sbjct: 306 SDDVREIHPDAVFEHADGFDRVDNERAVA 334


>gi|319783503|ref|YP_004142979.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169391|gb|ADV12929.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 330

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/145 (25%), Positives = 61/145 (42%), Gaps = 12/145 (8%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           + Q     + + +L+    V +      N   I   D AG+    Y  QL + ++     
Sbjct: 189 LAQNSAPINNLTALLSGSQVSQPNFVNANMPTIPTTDTAGLINTNYNQQLQKWQQDASSS 248

Query: 61  YDAVNMGYQLAPLV---SDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEI 111
            D +   + L   +   SDRR+K N++ +         Y + YL      +++GV+A E+
Sbjct: 249 SDLMGGLFGLGANLIKFSDRRLKKNIRAIGTFANGLTKYVFEYLW--GGGEQVGVMADEV 306

Query: 112 SKIRPDTVVENNQGIKSVDYGRLFN 136
              RP  V   N G  +VDYGR F 
Sbjct: 307 RAYRPYAVTTVN-GFDAVDYGRAFA 330


>gi|209548343|ref|YP_002280260.1| hypothetical protein Rleg2_0738 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534099|gb|ACI54034.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 334

 Score =  136 bits (342), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 59/149 (39%), Gaps = 16/149 (10%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQ-------NIYQNQLSER 53
           + ++ Q  +EI +LM    V +        T +  +D AG+          +Y  Q+S+ 
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPSYVNTPTTQLPNVDQAGLINDSFNQKMGLYDRQVSQS 248

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVI 107
                  +             SDRR+K +++ V  L      Y ++Y        +IG++
Sbjct: 249 NAAMGGLFGLGGTLLGGWA-KSDRRLKEDIRRVGTLDNGLPVYAFKYKD--GGPTQIGLM 305

Query: 108 AQEISKIRPDTVVENNQGIKSVDYGRLFN 136
           + ++ +  PD V E+  G   V Y R   
Sbjct: 306 SDDVRRTHPDAVFEHADGFDRVFYERAVA 334


>gi|126443127|ref|YP_001063336.1| hypothetical protein BURPS668_A2342 [Burkholderia pseudomallei 668]
 gi|126222618|gb|ABN86123.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 408

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/145 (24%), Positives = 61/145 (42%), Gaps = 16/145 (11%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
           Q  F ++ +L   V       +    +  +P + A   QN Y  QL++   G       +
Sbjct: 268 QLPFSQLATLASLV----PGNTGTAQSASSPANIAQAFQNQYAGQLNQYNTGVASANSTM 323

Query: 65  NMGYQLAP------LVSDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEIS 112
              + L        L+SDRR K ++  +       N Y++RY  +     R G++A E+ 
Sbjct: 324 GGLFGLGSAGLMGFLLSDRRSKTDIHAIGPAGDGVNFYRFRYRWEAPGTVRHGLMADEVK 383

Query: 113 KIRPDTVVENNQGIKSVDYGRLFNI 137
           ++RPD VV +  G   V+Y R    
Sbjct: 384 RVRPDAVVRHPSGYDLVNYNRALEA 408


>gi|167907339|ref|ZP_02494544.1| hypothetical protein BpseN_34235 [Burkholderia pseudomallei NCTC
           13177]
          Length = 399

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 36/145 (24%), Positives = 61/145 (42%), Gaps = 16/145 (11%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
           Q  F ++ +L   V       +    +  +P + A   QN Y  QL++   G       +
Sbjct: 259 QLPFSQLATLASLV----PGNTGTAQSASSPANIAQAFQNQYAGQLNQYNTGVASANSTM 314

Query: 65  NMGYQLAP------LVSDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEIS 112
              + L        L+SDRR K ++  +       N Y++RY  +     R G++A E+ 
Sbjct: 315 GGLFGLGSAGLMGFLLSDRRSKTDIHAIGSVGDGVNFYRFRYRWEAPGTVRHGLMADEVK 374

Query: 113 KIRPDTVVENNQGIKSVDYGRLFNI 137
           ++RPD VV +  G   V+Y R    
Sbjct: 375 RVRPDAVVRHPSGYDLVNYNRALEA 399


>gi|149925860|ref|ZP_01914124.1| Putative membrane-anchored cell surface protein, haemagluttinin
            [Limnobacter sp. MED105]
 gi|149825977|gb|EDM85185.1| Putative membrane-anchored cell surface protein, haemagluttinin
            [Limnobacter sp. MED105]
          Length = 2613

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 19/109 (17%)

Query: 56   GKKEFYDAVNMGYQLA---PLVSDRRMKCNVK-----------PVANLYQYRYLSDPKNV 101
                  D +  GY  A    + SDRR+K N++                Y Y YL++P   
Sbjct: 2253 RVAGNGDVIASGYMQATAFNVSSDRRLKTNIQVQDTGSVLSRLEQLQTYSYEYLANPNLG 2312

Query: 102  QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL-----FNIGQIQTKQK 145
            +RIGVIAQEI  + P+ V     G+ SVDY  L       +GQ+  + K
Sbjct: 2313 RRIGVIAQEIQNLFPEAVATRADGMMSVDYSALGAMAAMGVGQLSKQVK 2361


>gi|218510551|ref|ZP_03508429.1| hypothetical protein RetlB5_25766 [Rhizobium etli Brasil 5]
          Length = 271

 Score = 72.1 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 11/64 (17%), Positives = 25/64 (39%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           + ++ Q  +EI +LM    V +        T +  +D AG+    +  ++    +     
Sbjct: 189 LTERNQPLNEISALMSGSQVNQPNYVNTPTTQLPTVDQAGLINENFNQKMGIYNQQVAAR 248

Query: 61  YDAV 64
             A+
Sbjct: 249 NSAM 252


>gi|150396294|ref|YP_001326761.1| hypothetical protein Smed_1074 [Sinorhizobium medicae WSM419]
 gi|150027809|gb|ABR59926.1| hypothetical protein Smed_1074 [Sinorhizobium medicae WSM419]
          Length = 284

 Score = 71.7 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 71  APLVSDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
           A   SDRR+K ++  +A       +Y++RYL    +   +GV+AQE+ ++ P+ VV  + 
Sbjct: 181 ANEASDRRLKRDIARLAELANGLGVYRFRYLW--SDEVFVGVMAQEVLEVMPEAVVIGSD 238

Query: 125 GIKSVDYGRL 134
           G   V+Y +L
Sbjct: 239 GYMRVNYTKL 248


>gi|86360402|ref|YP_472290.1| hypothetical protein RHE_PE00125 [Rhizobium etli CFN 42]
 gi|86284504|gb|ABC93563.1| hypothetical protein RHE_PE00125 [Rhizobium etli CFN 42]
          Length = 217

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 75  SDRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           SDRR+K +++ +        +Y +RY+        +G +AQ++  IRPD + ++  G   
Sbjct: 111 SDRRLKTDIRRLGTSPAGIPIYAFRYIW--GGPLFVGTMAQDLLLIRPDVLSQDATGYYM 168

Query: 129 VDYGRL 134
           VDY RL
Sbjct: 169 VDYARL 174


>gi|149279316|ref|ZP_01885447.1| phage related tail fiber protein [Pedobacter sp. BAL39]
 gi|149229842|gb|EDM35230.1| phage related tail fiber protein [Pedobacter sp. BAL39]
          Length = 827

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 47/119 (39%), Gaps = 13/119 (10%)

Query: 40  GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV-SDRRMKCNVKPVA-------NLYQ 91
           G  Q     Q++    G     D          L  SDR +K N+  +         L  
Sbjct: 694 GEMQGPLTVQMNSPSTGVN--LDVGGYARSFGFLTNSDRSLKTNITRLGKSSEKLETLNG 751

Query: 92  YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI---GQIQTKQKKN 147
           Y Y         IG+IAQEI    P+ V  + +GI SVDYG+L      G  + +Q+ N
Sbjct: 752 YSYQWKINKRNDIGMIAQEIKAAFPEAVFTDQKGILSVDYGKLVAPLIEGHKEQQQQIN 810


>gi|241667087|ref|YP_002985171.1| hypothetical protein Rleg_7204 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862544|gb|ACS60209.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 224

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 76  DRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
           DRR+K  V+ +        +Y +RY+        IG +AQ++   RPD V++   G   V
Sbjct: 111 DRRLKTQVRRIGTSPSGIPVYAFRYIW--GGPLFIGTMAQDLLLTRPDAVLQTASGYYMV 168

Query: 130 DYGRL 134
            Y +L
Sbjct: 169 SYEKL 173


>gi|148557354|ref|YP_001264936.1| hypothetical protein Swit_4460 [Sphingomonas wittichii RW1]
 gi|148502544|gb|ABQ70798.1| hypothetical protein Swit_4460 [Sphingomonas wittichii RW1]
          Length = 424

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 54/138 (39%), Gaps = 16/138 (11%)

Query: 13  SLMQNVTVPKLPISLNNPTP---IAPIDYAGIAQNIYQNQLSE-----RKEGKKEFYDAV 64
           +L     +     +   PT     A      +  + YQ  L+           K    A 
Sbjct: 287 ALSLTDQLSNAQYAGYGPTTDLLKAGAAIPLMGMDSYQQALANLTNATNSSTSKGPGIAY 346

Query: 65  NMGYQLAPLVSDRRMKCNVKPVA------NLYQYRYLS-DPKNVQRIGVIAQEISKIRPD 117
           N+    A  +SDRR K N++ V        +Y + Y+  D    ++ GV+A E++ +RP 
Sbjct: 347 NVWSNAASSLSDRRTKTNIEKVGELDDGLGIYDFDYVDLDHGAGRQRGVMADEVAILRPW 406

Query: 118 TVV-ENNQGIKSVDYGRL 134
            +      G  +VDY +L
Sbjct: 407 ALGPRTADGFATVDYKKL 424


>gi|42523560|ref|NP_968940.1| hypothetical protein Bd2088 [Bdellovibrio bacteriovorus HD100]
 gi|39575766|emb|CAE79933.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio
            bacteriovorus HD100]
          Length = 1258

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 11/73 (15%)

Query: 75   SDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
            SDRR K +++ +              Y ++   +P   Q+IGVIAQE+  + P  V  + 
Sbjct: 1130 SDRRFKTDIEVIPDALNKALQIQGVTYHWKPGVNPDPSQQIGVIAQEVETVFPQAVKTDA 1189

Query: 124  QGIKSVDYGRLFN 136
             G KSV YG L  
Sbjct: 1190 DGYKSVTYGNLVA 1202


>gi|42522678|ref|NP_968058.1| putative YapH protein [Bdellovibrio bacteriovorus HD100]
 gi|39573874|emb|CAE79051.1| putative YapH protein [Bdellovibrio bacteriovorus HD100]
          Length = 1492

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 75   SDRRMKCNVK-------PVANLYQYRYLSD--PKNVQRIGVIAQEISKIRPDTVVENNQG 125
            SD R+K +++        V  L  Y Y         ++IG+IAQE+ K+ P+ V  +  G
Sbjct: 1358 SDARLKTDIQILPDSLNKVLGLNGYSYYWKNPENKEKQIGLIAQEVEKVFPEAVRTDKDG 1417

Query: 126  IKSVDYGRLFN 136
             KSV Y +L  
Sbjct: 1418 SKSVAYQKLVA 1428


>gi|15320624|ref|NP_203468.1| hypothetical protein Mx8p54 [Myxococcus phage Mx8]
 gi|15281734|gb|AAK94389.1|AF396866_54 p54 [Myxococcus phage Mx8]
          Length = 333

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 59/140 (42%), Gaps = 16/140 (11%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           + Q+ Q   E  +L   +++P      NN    +P DY G A   +   + + +   +  
Sbjct: 189 LRQRGQPMAEAQALQGFLSMPGF----NNAGAYSPTDYLGAAMGQHNANMGQWQASNQAN 244

Query: 61  YDAVNMGYQLAPL----VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQ 109
            D       +A      +SD RMK +++ +         L  + YL +P   + +GV+AQ
Sbjct: 245 ADVFGGLMNVASTLPFFLSDERMKKDIRRLPTEVMSGVHLATWEYLHEPGR-RYLGVVAQ 303

Query: 110 EISKIRPDTVVENNQGIKSV 129
           +++ + P  V     G+  V
Sbjct: 304 DVAAVAPHLVRTGPGGMLLV 323


>gi|149278064|ref|ZP_01884203.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
 gi|149231262|gb|EDM36642.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
          Length = 1026

 Score = 61.3 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 72  PLVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
            + SD R+K N+K +             +Y+Y+         +IGVIAQE+ K+ P+ VV
Sbjct: 902 AIPSDERLKTNIKTLTTVLQNLEQMRGVVYEYKDQHKYAAGPKIGVIAQELRKVYPEMVV 961

Query: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
               G   VDY +L   G +    K+   Q
Sbjct: 962 MGADGFFKVDYTQL--TGVLIQAVKEQQQQ 989


>gi|240850570|ref|YP_002971970.1| hypothetical protein Bgr_10160 [Bartonella grahamii as4aup]
 gi|240267693|gb|ACS51281.1| hypothetical protein Bgr_10160 [Bartonella grahamii as4aup]
          Length = 351

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 43/108 (39%), Gaps = 15/108 (13%)

Query: 40  GIAQNIYQNQLSERKEGKK-------EFYDAVNMGYQLAPLVSDRRMKCNVKPVAN---- 88
           G     Y  Q  +R            E    V         +SD R K N+  V      
Sbjct: 238 GAVAGNYGTQTGQRTTLTPQPKPNPWEIVGNVGTILGTFAGLSDIRAKENIVQVGQRDGH 297

Query: 89  -LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN-NQGIKSVDYGRL 134
            LY+Y Y   P+  +  GV+AQ++ K +P+ V  +   G   VDYG+L
Sbjct: 298 KLYEYNYKGYPE--RYRGVMAQDVLKSKPEAVFLHKATGFLHVDYGKL 343


>gi|158422473|ref|YP_001523765.1| hypothetical protein AZC_0849 [Azorhizobium caulinodans ORS 571]
 gi|158329362|dbj|BAF86847.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 367

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 39/113 (34%), Gaps = 14/113 (12%)

Query: 28  NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA 87
              T   P               S              +       +SDRR K ++  V 
Sbjct: 252 TQSTSTQPQSLLSNILGGALGLGSLFSAPAGGTSAIGGLL-----ALSDRRAKEDIAQVG 306

Query: 88  NL------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            L      Y++RY   P+    IG++AQ++ K  P+ V  +  G   VDYG  
Sbjct: 307 ELFDGQPVYRFRYKGAPE--THIGLMAQDVMKAVPEAVG-DMGGFLGVDYGAA 356


>gi|253583148|ref|ZP_04860356.1| predicted protein [Fusobacterium varium ATCC 27725]
 gi|251835040|gb|EES63593.1| predicted protein [Fusobacterium varium ATCC 27725]
          Length = 587

 Score = 59.4 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 12/88 (13%)

Query: 75  SDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ--- 124
           SD R+K N+KP       + NL  Y Y       + IGVIAQE+ ++ P+ V+E +    
Sbjct: 489 SDIRLKENLKPLTNTLDIIDNLNVYHYNWKDTKKEDIGVIAQEVEQVFPELVIEIDDPVK 548

Query: 125 -GIKSVDYGRLFNIG-QIQTKQKKNTAQ 150
             IK VDYG+L  +  Q   + K+   Q
Sbjct: 549 GKIKGVDYGKLATVSLQAIKELKQEITQ 576


>gi|42523143|ref|NP_968523.1| hypothetical protein Bd1641 [Bdellovibrio bacteriovorus HD100]
 gi|39575348|emb|CAE79516.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 692

 Score = 59.0 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 45/122 (36%), Gaps = 25/122 (20%)

Query: 39  AGIAQNIYQNQLSERKEGKKEFYDA---------VNMGYQLAPLVSDRRMKCNVKPV--- 86
            G   N Y   L+E   G                   G       SDRR K N+  +   
Sbjct: 523 TGTITNKYA-MLTEANAGSVGIGTLTPAYMLHVNGTAGGTSWANTSDRRFKRNIATIDSS 581

Query: 87  --------ANLYQYRYLSDPK----NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
                      Y +R    P+    N Q++G+IAQE+  + PD V ++N+G  +V Y  L
Sbjct: 582 LEKVLQLRGVTYDWRTDEFPQKNFENGQQVGLIAQEVQSVFPDVVTKDNEGFLAVQYANL 641

Query: 135 FN 136
             
Sbjct: 642 VA 643


>gi|255037099|ref|YP_003087720.1| hypothetical protein Dfer_3344 [Dyadobacter fermentans DSM 18053]
 gi|254949855|gb|ACT94555.1| hypothetical protein Dfer_3344 [Dyadobacter fermentans DSM 18053]
          Length = 397

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 45/107 (42%), Gaps = 13/107 (12%)

Query: 49  QLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ-------YRYLSDPK-- 99
           +L     G       + +   +    SDRR+K +  P++  ++       Y Y    K  
Sbjct: 245 KLQVYGNGGTLINGNLGV-NGIISESSDRRLKRDFSPLSTSFEKLSKLEGYHYYWKDKER 303

Query: 100 -NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
               + G+IAQ++  + P+ V  + +G KS++Y  L  I  +    K
Sbjct: 304 DQSLQTGLIAQDVETLFPELVKTDAKGFKSLNYTGL--IPHLIESVK 348


>gi|49475688|ref|YP_033729.1| hypothetical protein BH09310 [Bartonella henselae str. Houston-1]
 gi|49238495|emb|CAF27726.1| hypothetical genomic island protein [Bartonella henselae str.
           Houston-1]
          Length = 351

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 55/130 (42%), Gaps = 14/130 (10%)

Query: 19  TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
            + KL  +         +      Q   Q +L+  +         V         +SDRR
Sbjct: 229 QLSKLLAAGTASAGNYGMQTEQRTQFTPQTKLNPWQT-----IGNVGTILGTFAGLSDRR 283

Query: 79  MKCNVKPVA-----NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN-QGIKSVDYG 132
            K N++         LY+Y Y   P+  +  GV+AQ++ +  P+ V  NN  G+  VDY 
Sbjct: 284 AKENIREAGQKKGYTLYEYNYKGSPE--RYRGVMAQDVLRSNPEAVFYNNTTGLLHVDYD 341

Query: 133 RL-FNIGQIQ 141
           +L FN+ ++Q
Sbjct: 342 KLGFNMERVQ 351


>gi|301168297|emb|CBW27887.1| hypothetical protein BMS_3130 [Bacteriovorax marinus SJ]
          Length = 145

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 20/98 (20%)

Query: 73  LVSDRRMKCNVKPV---------ANLYQYRYLSDPK------NVQRIGVIAQEISKIRPD 117
             SD R K N+ P+          N Y Y Y ++          ++IGV+AQE+  + P 
Sbjct: 39  AGSDVRFKENINPLSDAMKGIASLNAYTYNYKTEEFPENKFSQREQIGVMAQELESVFPQ 98

Query: 118 TVVENNQGIKSVDYGRLF-----NIGQIQTKQKKNTAQ 150
            V E+ +G+K V+Y  L       + ++  K +   AQ
Sbjct: 99  AVAEDEKGMKYVNYSMLTPILLEAVKELNKKVEDQQAQ 136


>gi|323137875|ref|ZP_08072950.1| hypothetical protein Met49242DRAFT_2338 [Methylocystis sp. ATCC
           49242]
 gi|322396878|gb|EFX99404.1| hypothetical protein Met49242DRAFT_2338 [Methylocystis sp. ATCC
           49242]
          Length = 526

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 4/68 (5%)

Query: 71  APLVSDRRMKCNVKPVA----NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI 126
               SD R+K  V  +      L  YR++ +      +GV+AQE+ K+ P  V     G 
Sbjct: 437 GGRRSDLRLKHAVTLLGRLDNGLGFYRFIYNGGEKAFVGVMAQEVQKVMPQAVWRAPDGY 496

Query: 127 KSVDYGRL 134
             V Y ++
Sbjct: 497 LRVAYDKV 504


>gi|313768276|ref|YP_004061956.1| hypothetical protein MpV1_073 [Micromonas sp. RCC1109 virus MpV1]
 gi|312598972|gb|ADQ90996.1| hypothetical protein MpV1_073 [Micromonas sp. RCC1109 virus MpV1]
          Length = 256

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 49/129 (37%), Gaps = 26/129 (20%)

Query: 28  NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY--------DAVNMGYQLAPLV--SDR 77
           +   P+    +  +  NIY         G             D     Y    ++  SD 
Sbjct: 124 SQGNPVPVTQWTTLNSNIY------YSSGNVGIGTDIPGYTLDVNGTVYASGDVIMFSDE 177

Query: 78  RMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           R K N+KP+ N            +  + D    +  G+IAQEI K+ P+ V  ++ G+K 
Sbjct: 178 RKKTNIKPITNALDKVLQLRGVTFDKIGDGTR-RHAGIIAQEIEKVLPEVVYTDDDGMKG 236

Query: 129 VDYGRLFNI 137
           V YG +  +
Sbjct: 237 VAYGNIIAL 245


>gi|319405790|emb|CBI79416.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 343

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 8/94 (8%)

Query: 47  QNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-----LYQYRYLSDPKNV 101
           Q  L+++K+   +              +SD R K N+  V       LY Y Y   P+  
Sbjct: 244 QTSLTQQKQNPWKILGNAGSILGNWAGLSDVRAKENIIAVGQKNGHKLYDYNYKGYPE-- 301

Query: 102 QRIGVIAQEISKIRPDTVVEN-NQGIKSVDYGRL 134
           +  GVIAQE+ +  P+ V  N   G   VDY +L
Sbjct: 302 RYRGVIAQEVFQANPEAVFLNTATGFLHVDYNKL 335


>gi|163867718|ref|YP_001608920.1| hypothetical protein Btr_0470 [Bartonella tribocorum CIP 105476]
 gi|161017367|emb|CAK00925.1| hypothetical protein BT_0470 [Bartonella tribocorum CIP 105476]
          Length = 351

 Score = 56.7 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 40/108 (37%), Gaps = 15/108 (13%)

Query: 40  GIAQNIYQNQLSERKEGKK-------EFYDAVNMGYQLAPLVSDRRMKCNVKPVA----- 87
           G     Y  +  +             E    V         +SD R K N+         
Sbjct: 238 GAVAGNYGTRTGQMTTLTPQPKPNPWEIVGNVGTILGTFAGLSDTRAKENITEAGQRNGY 297

Query: 88  NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV-ENNQGIKSVDYGRL 134
            LY+Y Y   P+  +  GV+AQ++ K +P+ V   N  G   VDY +L
Sbjct: 298 TLYEYNYKGYPE--RYRGVMAQDVLKSKPEAVFYNNATGFLHVDYSKL 343


>gi|42524640|ref|NP_970020.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39576850|emb|CAE78079.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1567

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 50/122 (40%), Gaps = 15/122 (12%)

Query: 30   PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV--- 86
            P P      A    N     +      +K F +  + G      +SD R+K +++ +   
Sbjct: 1391 PGPTTATPDAITVTNAGNVYIGGNTGSRKLFVNGTSGGTAAWENLSDARLKSDIEVIPDS 1450

Query: 87   --------ANLYQYRYLSDPK----NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
                       + +R+   P       + +GVIAQ++ ++ P+ V ++ +G ++V Y +L
Sbjct: 1451 LKKILSLRGVTFNWRHDVRPDLDLIEKKDMGVIAQDVERVFPEAVDKDEKGFRAVAYTKL 1510

Query: 135  FN 136
              
Sbjct: 1511 IG 1512


>gi|156392170|ref|XP_001635922.1| predicted protein [Nematostella vectensis]
 gi|156223020|gb|EDO43859.1| predicted protein [Nematostella vectensis]
          Length = 576

 Score = 56.3 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 13/99 (13%)

Query: 47  QNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL-----------YQYRYL 95
             + +++ + K +    V     L  L SD R+K N+  +              + +R  
Sbjct: 460 AEKRAQKAKKKNKIVKTVAAVIGLGILFSDERLKQNITTIPGADYEAIGLREVEWVWRSQ 519

Query: 96  SDPKN--VQRIGVIAQEISKIRPDTVVENNQGIKSVDYG 132
           + P     +  GVIAQE+  + P  V     G K VDYG
Sbjct: 520 AGPLGLEGRGRGVIAQEVEGLYPAAVRLERNGYKRVDYG 558


>gi|255036291|ref|YP_003086912.1| hypothetical protein Dfer_2529 [Dyadobacter fermentans DSM 18053]
 gi|254949047|gb|ACT93747.1| hypothetical protein Dfer_2529 [Dyadobacter fermentans DSM 18053]
          Length = 456

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 11/89 (12%)

Query: 73  LVSDRRMKCNVK-------PVANLYQYRYLS---DPKNVQRIGVIAQEISKIRPDTVVEN 122
           L SD+R+K + K        ++ L  Y Y           + G+IAQE+ K+ P+ V  +
Sbjct: 337 LTSDKRLKTDFKNLSASLAKISQLQGYSYRWLDTTRTQTLQTGLIAQEVEKLFPELVNTD 396

Query: 123 NQGIKSVDY-GRLFNIGQIQTKQKKNTAQ 150
           + G KS++Y G + ++ +   + K  TAQ
Sbjct: 397 DNGYKSMNYNGLIPHLIEAVKELKGQTAQ 425


>gi|294661657|ref|YP_003580110.1| L-shaped tail fiber protein [Klebsiella phage KP15]
 gi|292660818|gb|ADE35066.1| L-shaped tail fiber protein [Klebsiella phage KP15]
          Length = 1328

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 54/132 (40%), Gaps = 20/132 (15%)

Query: 38   YAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV----------- 86
             A +  N Y    S       +F    N  +    + SDRR K ++K +           
Sbjct: 1196 QAILNVNGYGQDNSFYFRAGGDFICTRNGSFDNVEIRSDRRAKSDIKVIENALEKVEKLT 1255

Query: 87   ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ---GIKSVDYGRLF-----NIG 138
             N Y+    S     +  G+IAQE+ ++ P+ V ++ +   G+  ++Y  +      ++ 
Sbjct: 1256 GNTYELHNTS-GGTTRSAGLIAQEVQEVLPEAVTQDIEADGGLLRLNYNSVIALLVESVK 1314

Query: 139  QIQTKQKKNTAQ 150
            ++  + K+  +Q
Sbjct: 1315 ELSAEVKELKSQ 1326


>gi|257462745|ref|ZP_05627153.1| putative YapH protein [Fusobacterium sp. D12]
 gi|317060385|ref|ZP_07924870.1| predicted protein [Fusobacterium sp. D12]
 gi|313686061|gb|EFS22896.1| predicted protein [Fusobacterium sp. D12]
          Length = 542

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 74  VSDRRMKCNVKPVANLYQY-----RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           +SD+R+K N++ + N  +       Y       + +GVIAQE+ K  P+ V E   G  S
Sbjct: 453 LSDKRLKQNIEKIQNPLKILKKLNGYTFTMNKERHVGVIAQEVQKALPEAVRETENGYLS 512

Query: 129 VDYGRLFNI 137
           V YG +  +
Sbjct: 513 VAYGNMVGL 521


>gi|301101960|ref|XP_002900068.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262102643|gb|EEY60695.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 946

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 34/94 (36%), Gaps = 16/94 (17%)

Query: 66  MGYQLAPLVSDRRMKCNVKPVANL-----------YQYRYLSDPK-----NVQRIGVIAQ 109
           MG       SD R K ++  + N            Y Y     P        + +G IAQ
Sbjct: 851 MGSGAYVDASDERFKRDIHQITNASDVVAQLRGVEYAYNSAEFPSKFPLDGRRELGFIAQ 910

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTK 143
           E+ K  P  V  +  G K V Y RL  + +  T 
Sbjct: 911 EVEKAAPQVVSTDADGFKYVAYARLMPVVREATP 944


>gi|255037101|ref|YP_003087722.1| hypothetical protein Dfer_3346 [Dyadobacter fermentans DSM 18053]
 gi|254949857|gb|ACT94557.1| hypothetical protein Dfer_3346 [Dyadobacter fermentans DSM 18053]
          Length = 650

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 45/106 (42%), Gaps = 15/106 (14%)

Query: 40  GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP----LVSDRRMKCNVKPV--------- 86
           G       +Q+     G    +   N G           SDRR+K +  P+         
Sbjct: 486 GFVGMKTDDQVGLY-LGNSWMFWVDNGGTGYINNAIVQTSDRRLKRDFVPLSSSLGKLTS 544

Query: 87  ANLYQYRYLSDPKNV-QRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
            N Y Y +    ++   + G+IAQE+ K+ P+ V  +++G KS++Y
Sbjct: 545 LNGYHYFWKDKERDPSLQTGLIAQEVEKLFPELVKTDSKGFKSLNY 590


>gi|67478100|ref|XP_654472.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471518|gb|EAL49082.1| hypothetical protein EHI_006740 [Entamoeba histolytica HM-1:IMSS]
          Length = 692

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 56/141 (39%), Gaps = 23/141 (16%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQ-NQLSERKEGKKE 59
               QQ  +EI                +  TP+ P    GI +      ++    E  K 
Sbjct: 214 FTSPQQPQNEI----------PWDYLQSPSTPLTPTQMNGIIEKNEDFIRIERINENLKR 263

Query: 60  FYDAVNMGYQLAPL-VSDRRMKCNVKP---------VANLYQYRYLSDPKNVQRIGVIAQ 109
            +    +  +   L  SD R+K N+KP               + Y+      +++G IAQ
Sbjct: 264 LHVMGEIMAENGFLQRSDIRVKENIKPLVDSLNTVLQLTGTSFNYIGK--KEEKLGFIAQ 321

Query: 110 EISKIRPDTVVENNQGIKSVD 130
           E+ K+ P+ V+E+++G  +VD
Sbjct: 322 EVKKVCPELVIEDDKGELAVD 342


>gi|255036788|ref|YP_003087409.1| hypothetical protein Dfer_3029 [Dyadobacter fermentans DSM 18053]
 gi|254949544|gb|ACT94244.1| hypothetical protein Dfer_3029 [Dyadobacter fermentans DSM 18053]
          Length = 323

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 75  SDRRMKCNV-------KPVANLYQYRYLS---DPKNVQRIGVIAQEISKIRPDTVVENNQ 124
           SDRR+K ++         +  L  Y Y           + G +AQ++  + P+ V  + Q
Sbjct: 217 SDRRLKSDLTALQGSRHKILGLSGYHYRWASEKRSRALQTGFVAQDVEAVLPELVETDAQ 276

Query: 125 GIKSVDY 131
           G KSV+Y
Sbjct: 277 GYKSVNY 283


>gi|27378597|ref|NP_770126.1| hypothetical protein blr3486 [Bradyrhizobium japonicum USDA 110]
 gi|27351745|dbj|BAC48751.1| blr3486 [Bradyrhizobium japonicum USDA 110]
          Length = 558

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 75  SDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           SD  +K +V  +         Y++ YL   K    +GV+AQE+ +++P+ V   N G   
Sbjct: 472 SDIALKHDVVLLGYLANGLGYYRFSYLGSHKA--YVGVMAQEVERVKPEAVTRGNDGYLL 529

Query: 129 VDYGRL 134
           V Y +L
Sbjct: 530 VHYDKL 535


>gi|27380286|ref|NP_771815.1| hypothetical protein bll5175 [Bradyrhizobium japonicum USDA 110]
 gi|27353450|dbj|BAC50440.1| bll5175 [Bradyrhizobium japonicum USDA 110]
          Length = 552

 Score = 54.0 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 75  SDRRMKCNVKPVA----NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
           SD  +K +V  +      L  YR+  +  +   +GVIAQE+  +RPD V   + G   V 
Sbjct: 464 SDINLKHDVVLLGRLDNGLGYYRFAYNGSDKAYVGVIAQEVQTVRPDAVTRGSDGNLRVY 523

Query: 131 YGRL 134
           Y RL
Sbjct: 524 YERL 527


>gi|167380892|ref|XP_001735496.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165902496|gb|EDR28300.1| hypothetical protein EDI_244320 [Entamoeba dispar SAW760]
          Length = 692

 Score = 54.0 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 55/137 (40%), Gaps = 23/137 (16%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQ-NQLSERKEGKKEFYDA 63
           QQ  +EI                +  TP+ P    G+ +      ++    E  K  +  
Sbjct: 218 QQPQNEI----------PWDYLQSPSTPLTPTQMNGVIEKNEDFIRIERINENLKRLHVM 267

Query: 64  VNMGYQLAPL-VSDRRMKCNVKP---------VANLYQYRYLSDPKNVQRIGVIAQEISK 113
             +  +   L  SD R+K N+KP               + Y+      +++G IAQE+ K
Sbjct: 268 GEIMAENGFLQRSDIRVKENIKPLVDSLNTVLQLTGTSFNYIGK--KEEKLGFIAQEVKK 325

Query: 114 IRPDTVVENNQGIKSVD 130
           + P+ V+E+ +G  +VD
Sbjct: 326 VCPELVIEDEKGELAVD 342


>gi|260768854|ref|ZP_05877788.1| hypothetical protein VFA_001911 [Vibrio furnissii CIP 102972]
 gi|260616884|gb|EEX42069.1| hypothetical protein VFA_001911 [Vibrio furnissii CIP 102972]
          Length = 317

 Score = 53.6 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 37/98 (37%), Gaps = 14/98 (14%)

Query: 48  NQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKN 100
           N  + +++ K     A           SD R+K N+K           +Y + +    + 
Sbjct: 223 NSAAMQQQNKAGLLSAAGGLL---AAFSDIRLKKNIKATGEYTDRGNEIYTWDWNEKAEK 279

Query: 101 ----VQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
                   GVIA    ++ PD V  +  G K VDY R+
Sbjct: 280 LGLVGSSRGVIADHAEQVTPDAVSTDKSGYKVVDYARV 317


>gi|254503151|ref|ZP_05115302.1| hypothetical protein SADFL11_3190 [Labrenzia alexandrii DFL-11]
 gi|222439222|gb|EEE45901.1| hypothetical protein SADFL11_3190 [Labrenzia alexandrii DFL-11]
          Length = 208

 Score = 53.6 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 44/115 (38%), Gaps = 23/115 (20%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL--- 89
           IA +D  G+       Q++   +                   SDRR+K +V+ + +L   
Sbjct: 80  IAILDNNGLYNRDSLEQIAGSTQHAHSNGGGFG---------SDRRIKTDVQLIGHLDHL 130

Query: 90  ----YQYRYLSDPKNVQRIGVIAQEI--SKIRPDTVVENNQ----GIKSVDYGRL 134
               Y + Y ++P   + +GV+AQ++   +     V         G   VDY  L
Sbjct: 131 ELDVYSWEYTNEP-GARYVGVMAQDLLAREDLSHAVFIFEDGPHKGFYGVDYSVL 184


>gi|42522291|ref|NP_967671.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39574822|emb|CAE78664.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1267

 Score = 53.6 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 75   SDRRMKCNVKPV-------ANLYQYRYLS---DPKNVQRIGVIAQEISKIRPDTVVENNQ 124
            SDRR+K ++  +         +    Y        + + +G+IAQE+ K+ P+ V  + +
Sbjct: 1129 SDRRLKRDIATINSALDSILQINGVTYNWIDPSKGDQREVGLIAQEVEKVFPEVVKTDAK 1188

Query: 125  GIKSVDYGRLFN 136
            G+KSV Y  L +
Sbjct: 1189 GLKSVAYQNLVS 1200


>gi|42523988|ref|NP_969368.1| phage related tail fibre protein [Bdellovibrio bacteriovorus HD100]
 gi|39576196|emb|CAE80361.1| phage related tail fibre protein [Bdellovibrio bacteriovorus HD100]
          Length = 1164

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 17/76 (22%)

Query: 75   SDRRMKCNVK----------PVANLYQYRYLSDPKNVQR------IGVIAQEISKIRPDT 118
            SD+R+K N+            +  +Y + + S+            IGVIAQE+ K+ P+ 
Sbjct: 1036 SDQRLKKNITVIEGALEKILRLNGVY-FDWRSEEYPDWNFEQRHDIGVIAQEVEKVFPEA 1094

Query: 119  VVENNQGIKSVDYGRL 134
            V  +++G K+V Y +L
Sbjct: 1095 VRTDDKGFKAVAYSKL 1110


>gi|319408848|emb|CBI82505.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 339

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 36/103 (34%), Gaps = 8/103 (7%)

Query: 40  GIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPLVSDRRMKCNVKPVA---NLYQY 92
           G     Y  Q  +               V   +     +SDRR K N+  V        Y
Sbjct: 229 GAVSGNYGTQTGQATTLVPNNPWATVGGVGGIFGGLTGLSDRRAKENIVEVGYRDGHKLY 288

Query: 93  RYLSDPKNVQRIGVIAQEISKIRPDTVVEN-NQGIKSVDYGRL 134
            Y     + +  GV+AQ++    P+ V  N   G   VDY +L
Sbjct: 289 DYNYKGCSQRYRGVMAQDVLATNPEAVFLNTATGFLHVDYSKL 331


>gi|304413928|ref|ZP_07395345.1| hypothetical protein REG_1014 [Candidatus Regiella insecticola
           LSR1]
 gi|304283648|gb|EFL92043.1| hypothetical protein REG_1014 [Candidatus Regiella insecticola
           LSR1]
          Length = 414

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 22/81 (27%)

Query: 75  SDRRMKCNVKPVA----------NLY--------QYRYLSDPKNVQRIGVIAQEISKIRP 116
           SDRR+K ++KP+            +Y           Y+ +P    +IG+IA E+    P
Sbjct: 315 SDRRLKTHIKPLGPVLGKILQLQGIYYDWSDHSRTKDYIKEP----QIGLIADELQASFP 370

Query: 117 DTVVENNQGIKSVDYGRLFNI 137
           + V  +    K VDYGR   +
Sbjct: 371 ELVACDQDNFKYVDYGRFTAV 391


>gi|284035117|ref|YP_003385047.1| hypothetical protein Slin_0183 [Spirosoma linguale DSM 74]
 gi|283814410|gb|ADB36248.1| hypothetical protein Slin_0183 [Spirosoma linguale DSM 74]
          Length = 1168

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 47/143 (32%), Gaps = 24/143 (16%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD---------AVNM 66
               +     I  + PT  + ++    A       +     G                 N+
Sbjct: 983  NGASGNAYRIISSAPTTASAVNMELQAAGNANQLVLAATSGNVGIGTSAPSQKLHVVGNI 1042

Query: 67   GYQLAPLVSDRRMKCNVKPVAN----LYQYR---YLSDP--------KNVQRIGVIAQEI 111
                    SD R K NV  +      L Q R   Y               ++IG IAQE+
Sbjct: 1043 LASGTITPSDARFKENVATLNGSLAKLTQLRGVSYTHKAEFIKVRGLSAGKQIGFIAQEL 1102

Query: 112  SKIRPDTVVENNQGIKSVDYGRL 134
             K  P+ VV +  G K+VDY RL
Sbjct: 1103 EKTFPEFVVTSADGYKAVDYARL 1125


>gi|296447580|ref|ZP_06889501.1| hypothetical protein MettrDRAFT_3217 [Methylosinus trichosporium
           OB3b]
 gi|296254895|gb|EFH02001.1| hypothetical protein MettrDRAFT_3217 [Methylosinus trichosporium
           OB3b]
          Length = 143

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 14/84 (16%)

Query: 62  DAVNMGY-QLAPLVSDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEI--- 111
           DA+ + + +   L SDRR+K ++  +        LY++RY+ D +  +  G++AQ++   
Sbjct: 40  DAIGLVFNKRGELPSDRRLKTDIVSIGETENGLKLYRFRYIGDDR--EFCGLMAQDLLAD 97

Query: 112 SKIRPDTVVENNQGIKS-VDYGRL 134
            + R D V  N +G    VDY  +
Sbjct: 98  ERYR-DAVALNKEGYYYCVDYAAV 120


>gi|167386204|ref|XP_001737662.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165899432|gb|EDR26021.1| hypothetical protein EDI_013910 [Entamoeba dispar SAW760]
          Length = 619

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 16/123 (13%)

Query: 22  KLPISLNNPTPIA----PIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL-VSD 76
              I+     P      PI Y  +  N    ++    +  K  + A  +  +   L  SD
Sbjct: 205 NPNINQTTQIPQQISLNPIAYQLLTNNEEFIRVYMINQNIKRLHVAGEVFAENGFLQRSD 264

Query: 77  RRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           RR K +VK ++             Y+YL+D  +  R G IAQE+ ++ P+ V E+  G  
Sbjct: 265 RRSKKDVKKISDALNTILMVTGKSYKYLND--DKTRFGFIAQELKEVIPEAVREDEDGSL 322

Query: 128 SVD 130
           S+D
Sbjct: 323 SID 325


>gi|262067974|ref|ZP_06027586.1| putative phage tail fiber repeat-containing domain protein
           [Fusobacterium periodonticum ATCC 33693]
 gi|291378375|gb|EFE85893.1| putative phage tail fiber repeat-containing domain protein
           [Fusobacterium periodonticum ATCC 33693]
          Length = 892

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/150 (26%), Positives = 60/150 (40%), Gaps = 28/150 (18%)

Query: 11  ILSLMQNVTVPKLPISLNNPTPIAPIDYAGIA-----QNIYQNQLSERKEGKKEFYDAVN 65
           I    Q   V    IS +N    +P D AG       Q+   N+ S         +  + 
Sbjct: 724 ITHSSQGSGVDSFKISSSN----SPNDNAGGVDFGYTQDNTFNRTSFISSSGVGSFKMIT 779

Query: 66  MGY--------QLAP---LVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVI 107
            G         +L+    L SDRR+K  +K V N       L  Y +  +    +  G+I
Sbjct: 780 TGSDVNVGRNIKLSGDLFLTSDRRIKREIKKVDNALEKISKLNGYTFYKEGFKNKTAGII 839

Query: 108 AQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
           AQE+ ++ P+ V E N  I  V+Y  L ++
Sbjct: 840 AQEVKEVFPELVNEKNN-ILEVNYNGLHSL 868


>gi|67474538|ref|XP_653018.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56469935|gb|EAL47632.1| hypothetical protein EHI_178450 [Entamoeba histolytica HM-1:IMSS]
          Length = 626

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVS 75
           Q   +P+  ISL+        +     +    NQ  +R     E +       +     S
Sbjct: 210 QTTQIPQ-QISLSPIAYQLLTNNEEFIRVYMINQNIKRLHVAGEVFAENGFLQR-----S 263

Query: 76  DRRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI 126
           DRR K ++K ++             Y+YL+D  +  R G IAQE+ ++ P+ V E+  G 
Sbjct: 264 DRRSKKDIKKISDALNTILMITGKSYKYLND--DKTRFGFIAQELKEVIPEAVREDEDGS 321

Query: 127 KSVD 130
            S+D
Sbjct: 322 LSID 325


>gi|317504681|ref|ZP_07962646.1| cell wall surface anchor family protein [Prevotella salivae DSM
           15606]
 gi|315664208|gb|EFV03910.1| cell wall surface anchor family protein [Prevotella salivae DSM
           15606]
          Length = 807

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 17/103 (16%)

Query: 44  NIYQNQLS-----ERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV---------ANL 89
           NIYQN         R +  +   + + MG   A   SDRR+K N+K V            
Sbjct: 667 NIYQNGWQTALIISRDKTAQFHGNVLAMGGVTAYTTSDRRLKENIKAVDSMKVIRSLGGT 726

Query: 90  YQYRYLSDPKNVQRIGVIAQEIS-KIRPDTVVENNQGIKSVDY 131
           +Q+ Y    ++   +G IAQ +        V  N  G   ++Y
Sbjct: 727 WQFDYKGTGEHS--VGFIAQNVKGSALKSMVYTNADGYMKLNY 767


>gi|49476061|ref|YP_034102.1| hypothetical protein BH13970 [Bartonella henselae str. Houston-1]
 gi|49238869|emb|CAF28162.1| hypothetical protein BH13970 [Bartonella henselae str. Houston-1]
          Length = 374

 Score = 50.9 bits (120), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 76  DRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ-GIKSV 129
           D R K N+ PV       LY + Y  DP+  +  GV+AQE+ +++P+ V  N +  +  V
Sbjct: 278 DVRAKENIVPVGEKNGYPLYVFNYKGDPQ--RYCGVLAQEVLRLKPEAVFVNAKTKLLHV 335

Query: 130 DYGRL-FNIGQIQTKQKK 146
           DY ++   + +I   +K+
Sbjct: 336 DYNKIGLKMKKISEPKKR 353


>gi|42523208|ref|NP_968588.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39575413|emb|CAE79581.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1365

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 36/88 (40%), Gaps = 13/88 (14%)

Query: 62   DAVNMGYQLAPL-VSDRRMKCNV---------KPVANLYQYRYLSDP---KNVQRIGVIA 108
            D             SD R+K ++         + +  +    Y           ++G IA
Sbjct: 1219 DVNGTLRGFGITDSSDIRLKRDIASLSSSEALQRILKIQGVSYNWKNPEYGKRPQLGFIA 1278

Query: 109  QEISKIRPDTVVENNQGIKSVDYGRLFN 136
            QE+ KI P+ V  + QG+KSV+Y  L +
Sbjct: 1279 QELEKIYPELVETDPQGMKSVNYSHLVS 1306


>gi|221199531|ref|ZP_03572575.1| putative YapH protein [Burkholderia multivorans CGD2M]
 gi|221205568|ref|ZP_03578583.1| putative YapH protein [Burkholderia multivorans CGD2]
 gi|221174406|gb|EEE06838.1| putative YapH protein [Burkholderia multivorans CGD2]
 gi|221180816|gb|EEE13219.1| putative YapH protein [Burkholderia multivorans CGD2M]
          Length = 440

 Score = 50.9 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 50/130 (38%), Gaps = 22/130 (16%)

Query: 22  KLPISLNNPTPIAPIDYAG---IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV--SD 76
           +L    +N T I   D  G      + Y  +L         ++D     +    +   SD
Sbjct: 300 QLTADSSNNTDIINCDGGGRIRFINDAYNAEL--------GWFDNNGNFWARGDIQGFSD 351

Query: 77  RRMKCNVKPVANLYQ---------YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           RR+K N+K +              +         + +G IAQ++  I P+ V  + +G+K
Sbjct: 352 RRVKSNIKRIKGAMAKVRELVGVTFTRRRSKDKTRHMGFIAQDVEPIVPEVVHTDEKGMK 411

Query: 128 SVDYGRLFNI 137
           S+ Y  +  +
Sbjct: 412 SIAYANMTAL 421


>gi|319409246|emb|CBI82890.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 374

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 62/140 (44%), Gaps = 23/140 (16%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           M+Q  QA++ +  L++  T             +          ++ ++ L + ++     
Sbjct: 218 MEQDNQAWNRLEQLLKVGTTAAGNYGTQTGQSVT-------VPSVTKDPLRDAQQVLGLI 270

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIR 115
              +         +SD R+K N+  V       LY++ Y  DP+  +  GV+AQ++ +++
Sbjct: 271 GGIMG--------LSDARVKDNIVSVGEKNGYPLYEFNYKGDPQ--RYRGVMAQDLVRLK 320

Query: 116 PDTV-VENNQGIKSVDYGRL 134
           PD V +++   +  VDY ++
Sbjct: 321 PDAVHMDDKTQLLYVDYDKI 340


>gi|299142230|ref|ZP_07035363.1| hypothetical protein HMPREF0665_01821 [Prevotella oris C735]
 gi|298576319|gb|EFI48192.1| hypothetical protein HMPREF0665_01821 [Prevotella oris C735]
          Length = 831

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 13/102 (12%)

Query: 41  IAQNIYQNQLSERKEGKKEFYD-AVNMGYQLAPLVSDRRMKCNVKPV---------ANLY 90
           +  N +QN L   ++    FY   +  G   A   SDRR K N+K V            +
Sbjct: 690 VYNNGWQNALILSRDKNATFYGNVLAQGGVTAYTTSDRRSKENIKAVDSMKIIRSLGGTW 749

Query: 91  QYRYLSDPKNVQRIGVIAQEISKIRPDT-VVENNQGIKSVDY 131
           Q+ Y    K+   IG IAQ + +    + V  ++ G   ++Y
Sbjct: 750 QFDYKDTGKHG--IGFIAQSVRESMLKSMVYASDDGYLKLNY 789


>gi|167382030|ref|XP_001735950.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165901856|gb|EDR27843.1| hypothetical protein EDI_154750 [Entamoeba dispar SAW760]
          Length = 603

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 11/94 (11%)

Query: 49  QLSERKEGKKEFYDAVNMGYQLAPLV-SDRRMKCNVKPVAN-------LY--QYRYLSD- 97
           ++   +   ++ Y    +      LV SD+R K  ++ + N       LY  +++YL+D 
Sbjct: 179 KIKRIRNKVQQLYMLGEIFSNEGFLVRSDKRNKKEIEKINNALYGIKHLYGREFKYLTDL 238

Query: 98  PKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
                R G IAQE+ KI P+ V  + +G  +VDY
Sbjct: 239 ENKTPRYGFIAQEVKKIYPELVEIDEEGGLTVDY 272


>gi|92116480|ref|YP_576209.1| hypothetical protein Nham_0885 [Nitrobacter hamburgensis X14]
 gi|91799374|gb|ABE61749.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 541

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 75  SDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           SD ++K ++  +         Y++ YL   ++   +GVIAQE+  + P  V   + G   
Sbjct: 453 SDVKLKHDIVLLGYLANGLGYYRFSYLGSSES--YVGVIAQEVQSLVPQAVTRGSDGYLR 510

Query: 129 VDYGRL 134
           V Y +L
Sbjct: 511 VYYEKL 516


>gi|67477993|ref|XP_654427.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471466|gb|EAL49035.1| hypothetical protein EHI_083660 [Entamoeba histolytica HM-1:IMSS]
          Length = 698

 Score = 50.5 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 10/68 (14%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R K +++ + N           +Y Y ++P  ++  G IAQE+ ++ PD V ++ 
Sbjct: 267 VRSDARSKTDIQTIENALNSVTSLVGKKYAYKNEPNKIKY-GFIAQEVQEVIPDLVQKDE 325

Query: 124 QGIKSVDY 131
            G  SVDY
Sbjct: 326 SGNLSVDY 333


>gi|238801675|ref|YP_002922731.1| gp59 [Burkholderia phage BcepIL02]
 gi|237688050|gb|ACR15052.1| gp59 [Burkholderia phage BcepIL02]
          Length = 339

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 39/107 (36%), Gaps = 19/107 (17%)

Query: 42  AQNIYQNQL--SERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ-------- 91
               Y  +L   +         + V          SDRR+K N+K +             
Sbjct: 222 INQAYNAELLTCDNNGNVWVLGNIVG--------FSDRRLKSNIKRIKGAMAKVRELVGV 273

Query: 92  -YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
            +         + +G IAQ++  I P+ V  + +G+KS+ Y  L  +
Sbjct: 274 TFTRRRSKDKSRHMGFIAQDVEPIVPEVVRTDEKGMKSIAYPNLTAL 320


>gi|34419532|ref|NP_899545.1| long tail fiber distal subunit [Vibrio phage KVP40]
 gi|34333213|gb|AAQ64368.1| long tail fiber distal subunit [Vibrio phage KVP40]
          Length = 1094

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 71   APLVSDRRMKCNVKPVAN-------LYQYRY-LSDPKNVQRIGVIAQEISKIRPDTVVE- 121
                SD R+K NV+ + N       L  Y Y  +D +  ++ GVIAQE+ ++ P+ VVE 
Sbjct: 990  ITAYSDARVKTNVERITNPLEKIDRLNGYTYDRTDVECPRQTGVIAQEVLEVLPEAVVES 1049

Query: 122  --NNQGIKSVDYGRLFNI 137
              +  G  +V YG +  +
Sbjct: 1050 GGDADGHYAVAYGNMVGL 1067


>gi|124010598|ref|ZP_01695214.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
 gi|123982213|gb|EAY23814.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
          Length = 369

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 16/75 (21%)

Query: 73  LVSDRRMKCNVKPV------------ANLYQYRYLSDPKN----VQRIGVIAQEISKIRP 116
           L SD R K N++P+               Y++R     +      +++G+IAQE++++ P
Sbjct: 209 LTSDIRYKKNIQPLSTDVVAKLSQVRGTSYKFRTEEFKEKRFLKTKQVGIIAQELAQVYP 268

Query: 117 DTVVENNQGIKSVDY 131
           + V++   G  SV+Y
Sbjct: 269 ELVMKGADGYYSVNY 283


>gi|313675512|ref|YP_004053508.1| hypothetical protein Ftrac_1410 [Marivirga tractuosa DSM 4126]
 gi|312942210|gb|ADR21400.1| hypothetical protein Ftrac_1410 [Marivirga tractuosa DSM 4126]
          Length = 659

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 10/72 (13%)

Query: 76  DRRMKCNVKPV----ANLYQYR---YLSDPKNV---QRIGVIAQEISKIRPDTVVENNQG 125
           DRR+K N+  +    AN  + R   Y    +N    ++IG+IAQE+ ++ P+ V  + +G
Sbjct: 536 DRRLKKNISTLENSLANTLRLRGTTYYWKNENSSTERQIGLIAQEVEEVYPEFVHTDAEG 595

Query: 126 IKSVDYGRLFNI 137
            KSV+Y ++  +
Sbjct: 596 KKSVNYSQMTAV 607


>gi|183234067|ref|XP_652532.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169801272|gb|EAL47144.2| hypothetical protein EHI_112040 [Entamoeba histolytica HM-1:IMSS]
          Length = 559

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLYQ---------YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD+R K ++K ++N  +         Y+YL+D +  +R G IAQE+ ++ P+ V E+  G
Sbjct: 217 SDQRYKKDIKKISNALEKVLLLTGRSYKYLNDKQ--RRFGFIAQELKEVIPEAVKEDEDG 274

Query: 126 IKSVD 130
             S+D
Sbjct: 275 TLSID 279


>gi|22034301|gb|AAL01543.1| GP37 [Escherichia fergusonii]
          Length = 123

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 75  SDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           SD  +K N+KP       +  L    Y         +G+IAQ++ K+ P+ V    + IK
Sbjct: 31  SDENLKENIKPLDHSLEKILKLKGVSYTWKEDKTGDVGLIAQDVEKVYPELVKTKGE-IK 89

Query: 128 SVDYGRLFN 136
            VDY +L  
Sbjct: 90  QVDYQKLVA 98


>gi|67477509|ref|XP_654215.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471246|gb|EAL48829.1| hypothetical protein EHI_122890 [Entamoeba histolytica HM-1:IMSS]
          Length = 612

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 56/134 (41%), Gaps = 13/134 (9%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +EI+      T   L  S          +       +   ++   +   ++ Y    +  
Sbjct: 151 NEIIKTDSETTENILNNSQEYQIVEEGNNEEYKINELL--KIKGIRNKVQQLYMLGEIFS 208

Query: 69  QLAPLV-SDRRMKCNVKPV-ANLY--------QYRYLSDPKN-VQRIGVIAQEISKIRPD 117
               LV SD R K  ++ +   LY        +++YL DP++  +R G IAQE+ +I P+
Sbjct: 209 NEGFLVRSDERNKKEIEKIDKALYGLKHLYGREFKYLRDPEDKARRYGFIAQEVKEIYPE 268

Query: 118 TVVENNQGIKSVDY 131
            V  + +G  +VDY
Sbjct: 269 LVQIDEEGGLTVDY 282


>gi|29347275|ref|NP_810778.1| putative fiber protein [Bacteroides thetaiotaomicron VPI-5482]
 gi|253571396|ref|ZP_04848803.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298386931|ref|ZP_06996486.1| fiber protein [Bacteroides sp. 1_1_14]
 gi|29339174|gb|AAO76972.1| putative fiber protein [Bacteroides thetaiotaomicron VPI-5482]
 gi|251839349|gb|EES67433.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298260605|gb|EFI03474.1| fiber protein [Bacteroides sp. 1_1_14]
          Length = 203

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 19/80 (23%)

Query: 75  SDRRMKCNVKPVA---------NLYQYRYLSD----------PKNVQRIGVIAQEISKIR 115
           SD R K N+ P+          N   Y +               + + IG++AQE+ K+ 
Sbjct: 103 SDARAKININPLGYGLNVLSKLNAVSYDFKDKNEPAAAAFRVGGDGKEIGLLAQEVEKVL 162

Query: 116 PDTVVENNQGIKSVDYGRLF 135
           P+ V+ +  G K ++Y  + 
Sbjct: 163 PNIVLTDPDGNKLINYTAII 182


>gi|32469426|ref|NP_862890.1| PblB [Streptococcus phage SM1]
 gi|10732859|gb|AAG18640.1| PblB [Streptococcus phage SM1]
          Length = 1062

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 45/123 (36%), Gaps = 24/123 (19%)

Query: 46   YQNQLSERKEGKKEFYDAVNMGYQLAPL-----VSDRRMKCNVK----------PVANLY 90
            Y  Q    +E     Y     G   + +     +SDRR K N+K               Y
Sbjct: 937  YSPQYKRMEESNNYLY-LYRDGSSYSWIPMNKEISDRRYKSNIKDSQVSGLDIIEQLKTY 995

Query: 91   QYRYLSDPK-NVQRIGVIAQEISKIRPDTVVENNQG------IKSVDYGRLFNIGQIQTK 143
             YR   D K      G++AQ++ K  P+   EN  G       + V Y  +  I ++  K
Sbjct: 996  SYRKEYDGKIEDISCGIMAQDVQKYVPEAFFENPDGAYSYRTFELVPY-LIKAIQELNQK 1054

Query: 144  QKK 146
             +K
Sbjct: 1055 IQK 1057


>gi|85717460|ref|ZP_01048408.1| hypothetical protein NB311A_16474 [Nitrobacter sp. Nb-311A]
 gi|85695706|gb|EAQ33616.1| hypothetical protein NB311A_16474 [Nitrobacter sp. Nb-311A]
          Length = 537

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 8/66 (12%)

Query: 75  SDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           SD  +K ++  +         Y++ YL + K    +GVIAQ++  + P  V     G   
Sbjct: 449 SDVHLKDHIVLLGYLANGLGYYRFNYLGNSK--TYVGVIAQDVQNLMPQAVTRGRDGYLR 506

Query: 129 VDYGRL 134
           V Y +L
Sbjct: 507 VYYEKL 512


>gi|149004162|ref|ZP_01828959.1| hypothetical protein CGSSp14BS69_05677 [Streptococcus pneumoniae
           SP14-BS69]
 gi|147757824|gb|EDK64835.1| hypothetical protein CGSSp14BS69_05677 [Streptococcus pneumoniae
           SP14-BS69]
          Length = 602

 Score = 49.0 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
               +     N     +P+   GI                      +++ V  G     +
Sbjct: 445 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 504

Query: 74  --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
              SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 505 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 563

Query: 122 ---NNQGIKSVDYGRL 134
              N  G   +DY  L
Sbjct: 564 DPENPDGYLHIDYTAL 579


>gi|254444266|ref|ZP_05057742.1| hypothetical protein VDG1235_2505 [Verrucomicrobiae bacterium
           DG1235]
 gi|198258574|gb|EDY82882.1| hypothetical protein VDG1235_2505 [Verrucomicrobiae bacterium
           DG1235]
          Length = 454

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 43/93 (46%), Gaps = 13/93 (13%)

Query: 51  SERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLY---------QYRYLSDPKNV 101
                        V + +  +   SDRR+K +++P+ ++           Y + + P+  
Sbjct: 325 GNANFTVNTSGVVVGLLFSQS---SDRRLKQDIEPINDVLPRLAQLEAKSYHFKASPEVG 381

Query: 102 QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            + G IAQ++ ++ P+ V E+ + + S++Y  L
Sbjct: 382 LQYGFIAQDVQEVFPEVVGESGEHL-SLNYTAL 413


>gi|240851418|ref|YP_002972497.1| putative phage related protein [Bartonella grahamii as4aup]
 gi|240268541|gb|ACS52129.1| putative phage related protein [Bartonella grahamii as4aup]
          Length = 379

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 8/65 (12%)

Query: 76  DRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ-GIKSV 129
           D R K N+ PV       LY + Y  +P+  Q  GV+AQ++ +++P+ V  N +  +  V
Sbjct: 278 DVRAKENIIPVGQKKGYPLYTFNYKGNPQRYQ--GVMAQDVLRVKPEAVYVNAKTKLLHV 335

Query: 130 DYGRL 134
           DYG++
Sbjct: 336 DYGKI 340


>gi|29349237|ref|NP_812740.1| hypothetical protein BT_3829 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29341145|gb|AAO78934.1| conserved hypothetical protein [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 203

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 33/80 (41%), Gaps = 19/80 (23%)

Query: 75  SDRRMKCNVKPVA---------NLYQYRYLSD----------PKNVQRIGVIAQEISKIR 115
           SD R K N+ P+          N   Y +               + + IG++AQE+ K+ 
Sbjct: 103 SDARAKININPLGYGLNVLSKLNAVSYDFKDKNEPAAAAFRVGGDGKEIGLLAQEVEKVL 162

Query: 116 PDTVVENNQGIKSVDYGRLF 135
           P+ V+ +  G K + Y  + 
Sbjct: 163 PNIVLTDPDGNKLISYTAII 182


>gi|124002008|ref|ZP_01686862.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
 gi|123992474|gb|EAY31819.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
          Length = 617

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 42/103 (40%), Gaps = 17/103 (16%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV------------ANLYQY 92
            +   +   + G    +  +      + L SD R K ++ P+             N YQ+
Sbjct: 472 NWDGSILTLQRGGNATFKGMVSANG-SQLYSDARFKKDITPITTGLIAKLDQLQGNTYQW 530

Query: 93  RYLSDPKN----VQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           R     +       ++G IAQE+ ++ P+ V  ++ G  S++Y
Sbjct: 531 RNDEFTERNFVEGTQLGFIAQEMQEVFPELVSADSDGYLSINY 573


>gi|321157252|emb|CBW39235.1| PblB-type protein [Streptococcus phage 2167]
          Length = 1469

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1312 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1371

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1372 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 1430

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1431 DPENPDGYLHIDYTAL 1446


>gi|321157149|emb|CBW39134.1| PblB-type protein [Streptococcus phage 11865]
          Length = 1421

 Score = 48.6 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1264 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1323

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1324 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 1382

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1383 DPENPDGYLHIDYTAL 1398


>gi|148986194|ref|ZP_01819146.1| phage-related protein; possible prophage LambdaBa01, minor structural
            protein [Streptococcus pneumoniae SP3-BS71]
 gi|147921808|gb|EDK72936.1| phage-related protein; possible prophage LambdaBa01, minor structural
            protein [Streptococcus pneumoniae SP3-BS71]
          Length = 1203

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1046 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1105

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1106 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1164

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1165 DPENPDGYLHIDYTAL 1180


>gi|67478702|ref|XP_654733.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471804|gb|EAL49347.1| hypothetical protein EHI_194560 [Entamoeba histolytica HM-1:IMSS]
          Length = 562

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD+R K ++K ++             ++Y+++ +   R G IAQE+ ++ P+ V E+  G
Sbjct: 220 SDKRSKKDIKKISHALDTICKITGKSFKYVNEDR--TRFGFIAQELKEVIPEAVKEDEDG 277

Query: 126 IKSVD 130
             S+D
Sbjct: 278 RLSID 282


>gi|94967383|ref|YP_589431.1| hypothetical protein Acid345_0352 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549433|gb|ABF39357.1| hypothetical protein Acid345_0352 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 1037

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 13/84 (15%)

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNV------------KPVANLYQYRYLSDPKNV 101
           K         +N   +L    S RR K N+            +PV   Y+  Y  D  +V
Sbjct: 895 KTSSSGITVLINSTGKLGTTTSSRRFKQNIANIPDSSKLFQLRPVTFFYRPEY-DDGTHV 953

Query: 102 QRIGVIAQEISKIRPDTVVENNQG 125
           ++ G+IA+E++KI PD VV +NQG
Sbjct: 954 RQYGLIAEEVAKIYPDLVVFDNQG 977


>gi|321156928|emb|CBW38917.1| PblB-type protein [Streptococcus phage V22]
          Length = 1468

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1311 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1370

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1371 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 1429

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1430 DPENPDGYLHIDYTAL 1445


>gi|303255532|ref|ZP_07341590.1| hypothetical protein CGSSpBS455_08580 [Streptococcus pneumoniae
           BS455]
 gi|302597510|gb|EFL64598.1| hypothetical protein CGSSpBS455_08580 [Streptococcus pneumoniae
           BS455]
          Length = 965

 Score = 48.2 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
               +     N     +P+   GI                      +++ V  G     +
Sbjct: 808 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 867

Query: 74  --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
              SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 868 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 926

Query: 122 ---NNQGIKSVDYGRL 134
              N  G   +DY  L
Sbjct: 927 DPENPDGYLHIDYTAL 942


>gi|149011808|ref|ZP_01833004.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP19-BS75]
 gi|147764239|gb|EDK71171.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP19-BS75]
          Length = 1352

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1195 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1254

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1255 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 1313

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1314 DPENPDGYLHIDYTAL 1329


>gi|332072362|gb|EGI82845.1| pblB [Streptococcus pneumoniae GA17570]
          Length = 2147

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1990 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2049

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2050 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ESKKHEEIGLIAQEAETIVPRIVSR 2108

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2109 DPENPDGYLHIDYTAL 2124


>gi|183603147|ref|ZP_02712966.2| PblB [Streptococcus pneumoniae SP195]
 gi|183572670|gb|EDT93198.1| PblB [Streptococcus pneumoniae SP195]
          Length = 2135

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1978 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2037

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2038 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ESKKHEEIGLIAQEAETIVPRIVSR 2096

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2097 DPENPDGYLHIDYTAL 2112


>gi|307128260|ref|YP_003880291.1| PblB [Streptococcus pneumoniae 670-6B]
 gi|306485322|gb|ADM92191.1| PblB [Streptococcus pneumoniae 670-6B]
          Length = 2426

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 2269 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2328

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2329 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 2387

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2388 DPENPDGYLHIDYTAL 2403


>gi|168494864|ref|ZP_02719007.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|168495066|ref|ZP_02719209.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|183575070|gb|EDT95598.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|183575230|gb|EDT95758.1| PblB [Streptococcus pneumoniae CDC3059-06]
          Length = 1349

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1192 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1251

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1252 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 1310

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1311 DPENPDGYLHIDYTAL 1326


>gi|168494815|ref|ZP_02718958.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|183575310|gb|EDT95838.1| PblB [Streptococcus pneumoniae CDC3059-06]
          Length = 2676

 Score = 47.8 bits (112), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 2519 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2578

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2579 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 2637

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2638 DPENPDGYLHIDYTAL 2653


>gi|148996415|ref|ZP_01824133.1| phage infection protein [Streptococcus pneumoniae SP11-BS70]
 gi|147756990|gb|EDK64029.1| phage infection protein [Streptococcus pneumoniae SP11-BS70]
          Length = 1034

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 877  SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 936

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 937  EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 995

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 996  DPENPDGYLHIDYTAL 1011


>gi|301799204|emb|CBW31717.1| pblB [Streptococcus pneumoniae OXC141]
          Length = 2101

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1944 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2003

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2004 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 2062

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2063 DPENPDGYLHIDYTAL 2078


>gi|167377056|ref|XP_001734269.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904350|gb|EDR29592.1| hypothetical protein EDI_210770 [Entamoeba dispar SAW760]
          Length = 674

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 37/151 (24%), Positives = 65/151 (43%), Gaps = 25/151 (16%)

Query: 1   MDQKQQAF-----HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQN----QLS 51
           + Q    F     H+I + +++V + +   S    T IA  +   I  NI  N    ++ 
Sbjct: 164 ITQNNYPFSFLPTHQINNQIESVKIEQPFQSA---TTIAIEEINQINSNIQDNTEFIKIE 220

Query: 52  ERKEGKKEFYDAVNMGYQLAP--LVSDRRMKCNVKPVANLY---------QYRYLSDPKN 100
           E     K  +      +      + SD R K +++ + N           +Y Y ++P  
Sbjct: 221 EITNQIKRLH-VFGEIFAENGYFVRSDVRSKTDIQIIENALNSILSLVGKKYSYKNEPNK 279

Query: 101 VQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           V+  G IAQE+ K+ P+ V +++ G  SVDY
Sbjct: 280 VKY-GFIAQEVQKVIPNLVQKDDTGNLSVDY 309


>gi|307066694|ref|YP_003875660.1| PblB, putative [Streptococcus pneumoniae AP200]
 gi|306408231|gb|ADM83658.1| PblB, putative [Streptococcus phage PhiSpn_200]
          Length = 3035

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 2878 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2937

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2938 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 2996

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2997 DPENPDGYLHIDYTAL 3012


>gi|169833508|ref|YP_001693486.1| hypothetical protein SPH_0062 [Streptococcus pneumoniae Hungary19A-6]
 gi|168996010|gb|ACA36622.1| PblB [Streptococcus pneumoniae Hungary19A-6]
          Length = 3038

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 2881 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2940

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2941 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 2999

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 3000 DPENPDGYLHIDYTAL 3015


>gi|307126242|ref|YP_003878273.1| PblB [Streptococcus pneumoniae 670-6B]
 gi|306483304|gb|ADM90173.1| PblB [Streptococcus pneumoniae 670-6B]
          Length = 2699

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 2542 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2601

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2602 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPKIVSR 2660

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2661 DPENPDGYLHIDYTAL 2676


>gi|321157103|emb|CBW39089.1| PblB-type protein [Streptococcus phage 23782]
          Length = 1707

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1550 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1609

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1610 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1668

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1669 DPENPDGYLHIDYTAL 1684


>gi|332205033|gb|EGJ19096.1| pblB [Streptococcus pneumoniae GA47368]
          Length = 1137

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 980  SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYWM 1039

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1040 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1098

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1099 DPENPDGYLHIDYTAL 1114


>gi|168490166|ref|ZP_02714365.1| PblB [Streptococcus pneumoniae SP195]
 gi|183571459|gb|EDT91987.1| PblB [Streptococcus pneumoniae SP195]
          Length = 3023

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ +  G     +
Sbjct: 2866 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQIGSGSVKYWM 2925

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2926 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 2984

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2985 DPENPDGYLHIDYTAL 3000


>gi|321157197|emb|CBW39181.1| PblB-type protein [Streptococcus phage 8140]
          Length = 1179

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1022 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1081

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1082 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1140

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1141 DPENPDGYLHIDYTAL 1156


>gi|303261114|ref|ZP_07347063.1| PblB [Streptococcus pneumoniae SP14-BS292]
 gi|303263442|ref|ZP_07349365.1| PblB [Streptococcus pneumoniae BS397]
 gi|303267835|ref|ZP_07353637.1| PblB [Streptococcus pneumoniae BS458]
 gi|302637951|gb|EFL68437.1| PblB [Streptococcus pneumoniae SP14-BS292]
 gi|302642531|gb|EFL72876.1| PblB [Streptococcus pneumoniae BS458]
 gi|302647215|gb|EFL77439.1| PblB [Streptococcus pneumoniae BS397]
          Length = 2105

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1948 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2007

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2008 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 2066

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2067 DPENPDGYLHIDYTAL 2082


>gi|321156986|emb|CBW38974.1| PblB-type protein [Streptococcus phage 040922]
          Length = 2102

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1945 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYWM 2004

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2005 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 2063

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2064 DPENPDGYLHIDYTAL 2079


>gi|303259359|ref|ZP_07345336.1| PblB [Streptococcus pneumoniae SP-BS293]
 gi|303265734|ref|ZP_07351632.1| PblB [Streptococcus pneumoniae BS457]
 gi|302639293|gb|EFL69751.1| PblB [Streptococcus pneumoniae SP-BS293]
 gi|302644642|gb|EFL74891.1| PblB [Streptococcus pneumoniae BS457]
          Length = 1530

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1373 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1432

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1433 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1491

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1492 DPENPDGYLHIDYTAL 1507


>gi|149021849|ref|ZP_01835856.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
           SP23-BS72]
 gi|147930085|gb|EDK81072.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
           SP23-BS72]
          Length = 999

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
               +     N     +P+   GI                      +++ V  G     +
Sbjct: 842 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 901

Query: 74  --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
              SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 902 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 960

Query: 122 ---NNQGIKSVDYGRL 134
              N  G   +DY  L
Sbjct: 961 DPENPDGYLHIDYTAL 976


>gi|307710000|ref|ZP_07646446.1| hypothetical protein SMSK564_1275 [Streptococcus mitis SK564]
 gi|307619258|gb|EFN98388.1| hypothetical protein SMSK564_1275 [Streptococcus mitis SK564]
          Length = 694

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 11/69 (15%)

Query: 68  YQLAPLVSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR---IGVIAQEISKIRP 116
           +      SDRR+K N++         +  L  Y Y  +  N       G++AQ++ K  P
Sbjct: 594 FPAWNDTSDRRLKSNIQESSVSGVDVINRLKTYSYRKEFNNEVEDISCGIMAQDVQKYAP 653

Query: 117 DTVVENNQG 125
           D   E   G
Sbjct: 654 DAFREGPDG 662


>gi|321157044|emb|CBW39031.1| PblB-type protein [Streptococcus phage 34117]
          Length = 1633

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1476 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYWM 1535

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1536 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1594

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1595 DPENPDGYLHIDYTAL 1610


>gi|172079550|ref|ZP_02708651.2| PblB [Streptococcus pneumoniae CDC1873-00]
 gi|172043007|gb|EDT51053.1| PblB [Streptococcus pneumoniae CDC1873-00]
          Length = 2654

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 2497 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYWM 2556

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2557 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 2615

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2616 DPENPDGYLHIDYTAL 2631


>gi|118197621|ref|YP_874014.1| distal tail fiber protein [Thermus phage phiYS40]
 gi|116266312|gb|ABJ91395.1| distal tail fiber protein [Thermus phage phiYS40]
          Length = 643

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 7/79 (8%)

Query: 75  SDRRMKCNVKPVANLYQ-----YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
           SD R K N++P+ +  +       Y  + +  +  G+IAQE+  + P+ V  +  G   +
Sbjct: 548 SDARFKTNLEPIQDALEKLGQITGYTFEMRGKRLAGLIAQEVQNVLPEAVDVDQNGYLQL 607

Query: 130 DYGRLFN--IGQIQTKQKK 146
           +Y  +    +  ++ K+KK
Sbjct: 608 NYNAVVALLVEALKEKKKK 626


>gi|148995279|ref|ZP_01824069.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP9-BS68]
 gi|147926790|gb|EDK77848.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP9-BS68]
          Length = 1602

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1445 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1504

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1505 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ESKKHEEIGLIAQEAETIVPRIVSR 1563

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1564 DPENPDGYLHIDYTAL 1579


>gi|298713329|emb|CBJ33556.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 759

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 39/103 (37%), Gaps = 27/103 (26%)

Query: 59  EFYDAVNMGYQLAPLV--SDRRMKCNVKPVA---------NLYQYRYLSDP--------- 98
                        P +  SD RMK  VK ++          L    Y+  P         
Sbjct: 512 GSVTVSGAVMGRGPYMDTSDARMKMEVKDISASDAMAVMKGLRAVTYVLKPEALLASKAR 571

Query: 99  -------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
                   + ++ G IAQE+ ++ P+ V E++ G K+V Y RL
Sbjct: 572 NSQTRTHGDRRQHGFIAQEVEQVAPEVVAEDSNGYKTVAYSRL 614


>gi|167396330|ref|XP_001742013.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165893164|gb|EDR21505.1| hypothetical protein EDI_049010 [Entamoeba dispar SAW760]
          Length = 411

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 10/68 (14%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R K +++ + N           +Y Y ++P  ++  G IAQE+ ++ PD V ++ 
Sbjct: 267 VRSDARSKTDIQTIENALNSVTSLVGKKYAYKNEPNKIKY-GFIAQEVQEVIPDLVQKDE 325

Query: 124 QGIKSVDY 131
            G  SVDY
Sbjct: 326 SGNLSVDY 333


>gi|325185065|emb|CCA19557.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 965

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 16/88 (18%)

Query: 66  MGYQLAPLVSDRRMKCNV---------KPVANLYQYRY------LSDPKNVQR-IGVIAQ 109
           MG       SD R K N+           ++ L    Y        +  + +R IG IAQ
Sbjct: 839 MGSGAYVDASDLRFKTNITYLTGGGSLHIISQLRAAEYNFKNATKWNKTHRKREIGFIAQ 898

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLFNI 137
           E+ K+ P  V E+ QG K V Y R+  +
Sbjct: 899 EVEKVLPQVVTEDAQGFKYVAYARIIPV 926


>gi|225855356|ref|YP_002736868.1| PblB [Streptococcus pneumoniae JJA]
 gi|225722631|gb|ACO18484.1| PblB [Streptococcus pneumoniae JJA]
          Length = 2108

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1951 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2010

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2011 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 2069

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2070 DPENPDGYLHIDYTAL 2085


>gi|148990394|ref|ZP_01821566.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP6-BS73]
 gi|147924349|gb|EDK75441.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP6-BS73]
          Length = 1053

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 896  SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYWM 955

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 956  EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1014

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1015 DPENPDGYLHIDYTAL 1030


>gi|67482263|ref|XP_656481.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56473651|gb|EAL51066.1| hypothetical protein EHI_187050 [Entamoeba histolytica HM-1:IMSS]
          Length = 489

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 15/128 (11%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
             L   +   K   + N    I P            N+  +R     E +       +  
Sbjct: 87  TGLGDTIESSKEIENNNQIISITPSCNEDFITIQSVNKNIKRLCIAGELFSEAGFFQR-- 144

Query: 72  PLVSDRRMKCNVKPVANL---------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
              SD+R K  ++ +            Y + Y +D  N Q+ G +AQE+ KI P+TV   
Sbjct: 145 ---SDQRNKNEIQKITGALEQLKNVVGYSFVYKNDENN-QKYGFMAQELQKIYPNTVKVL 200

Query: 123 NQGIKSVD 130
             G  S+D
Sbjct: 201 PDGTLSID 208


>gi|317503032|ref|ZP_07961112.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
 gi|315665832|gb|EFV05419.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
          Length = 306

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 32/81 (39%), Gaps = 12/81 (14%)

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPV---------ANLYQYRYLSDPKNVQRIGVIAQEI 111
            + +  G   A   SDRR+K N+K V            +Q+ Y    ++   IG IAQ +
Sbjct: 188 GNVLAQGGVTAYTTSDRRLKENIKQVDSMRIIRSLGGTWQFDYKDTGEHS--IGFIAQSV 245

Query: 112 S-KIRPDTVVENNQGIKSVDY 131
                   V  N  G   ++Y
Sbjct: 246 KGSALGSMVYTNADGYMKLNY 266


>gi|49474618|ref|YP_032660.1| hypothetical protein BQ11070 [Bartonella quintana str. Toulouse]
 gi|49240122|emb|CAF26568.1| hypothetical protein BQ11070 [Bartonella quintana str. Toulouse]
          Length = 374

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 75  SDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ-GIKS 128
           SD R K N+ P+       +Y + Y  DP+  +  GVIAQ++ +++PD V  N +  +  
Sbjct: 277 SDLRAKENIVPIGEKNGYPIYIFNYKGDPQLYR--GVIAQDVLRLKPDAVYINAKTKLLH 334

Query: 129 VDYGRL-FNIGQIQTKQKK 146
           VDY ++   I +I   + K
Sbjct: 335 VDYRKIGLQIEKITASKNK 353


>gi|312200835|ref|YP_004020896.1| hypothetical protein FraEuI1c_7061 [Frankia sp. EuI1c]
 gi|311232171|gb|ADP85026.1| hypothetical protein FraEuI1c_7061 [Frankia sp. EuI1c]
          Length = 823

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 99  KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
           +  + +G+IAQE+  + P+ V     G++ +DYG+L  +
Sbjct: 754 RGRREVGLIAQEVEAVMPELVGVGADGVRGIDYGKLTAV 792


>gi|225857876|ref|YP_002739386.1| PblB [Streptococcus pneumoniae 70585]
 gi|225722145|gb|ACO17999.1| PblB [Streptococcus pneumoniae 70585]
          Length = 2970

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 2813 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2872

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 2873 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 2931

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 2932 DPENPDGYLHIDYTAL 2947


>gi|332201943|gb|EGJ16012.1| phage minor structural , N-terminal region domain protein
            [Streptococcus pneumoniae GA41317]
          Length = 1924

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 45/136 (33%), Gaps = 20/136 (14%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQLAPL 73
                +     N     +P+   GI                      +++ V  G     +
Sbjct: 1767 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1826

Query: 74   --VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               SDRR+K N+   A           +  + ++ + K  + IG+IAQE   I P  V  
Sbjct: 1827 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQEAETIVPRIVSR 1885

Query: 122  ---NNQGIKSVDYGRL 134
               N  G   +DY  L
Sbjct: 1886 DPENPDGYLHIDYTAL 1901


>gi|332826387|gb|EGJ99230.1| hypothetical protein HMPREF9455_00554 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 840

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 38/88 (43%), Gaps = 11/88 (12%)

Query: 50  LSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQY-------RYLSDPKNVQ 102
           +           + ++ G     + SDRR+K ++KP+     +        Y+ +  N +
Sbjct: 698 MGASNHSTIRIGNLLSNGSGSWTVTSDRRLKHDIKPIGQGLDFIKKLKPVEYIYNTGNGK 757

Query: 103 R-IGVIAQEISKIRPDTVVENNQGIKSV 129
           + +G IAQ++ ++  +   EN  G   V
Sbjct: 758 KSLGFIAQDLQQVMAE---ENMSGYSLV 782


>gi|299142843|ref|ZP_07035971.1| hypothetical protein HMPREF0665_02453 [Prevotella oris C735]
 gi|298575711|gb|EFI47589.1| hypothetical protein HMPREF0665_02453 [Prevotella oris C735]
          Length = 878

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 32/81 (39%), Gaps = 12/81 (14%)

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPV---------ANLYQYRYLSDPKNVQRIGVIAQEI 111
            + +  G   A   SDRR+K N+K V            +Q+ Y    ++   IG IAQ +
Sbjct: 758 GNVLAQGGVTAYTTSDRRLKENIKAVDSVKVIRSLGGTWQFDYKDSGEHS--IGFIAQSV 815

Query: 112 S-KIRPDTVVENNQGIKSVDY 131
                   +  N  G   ++Y
Sbjct: 816 KGSALRSMIYTNADGYMKLNY 836


>gi|42524641|ref|NP_970021.1| putative cell wall surface anchor family protein [Bdellovibrio
            bacteriovorus HD100]
 gi|39576851|emb|CAE78080.1| putative cell wall surface anchor family protein [Bdellovibrio
            bacteriovorus HD100]
          Length = 1507

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 44/136 (32%), Gaps = 22/136 (16%)

Query: 18   VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERK----EGKKEFYDAVNMGYQLAPL 73
            +       S    T       +G       N++   +            A      +  L
Sbjct: 1300 IQFYARTASPTTRTGYFGTPASGSTNMNVANEMEGGQIDFLTKSGGAVSAKMTLSAVGNL 1359

Query: 74   V--------SDRRMKCNVK-------PVANLYQYRYLSDPKNV---QRIGVIAQEISKIR 115
                     SD R+K  +         +  L    Y     N     ++G IAQE+ K+ 
Sbjct: 1360 TTAGTVNGASDIRLKKEIHVLDGSLDKILQLKPSSYHWKDPNADPRLQMGFIAQELEKVY 1419

Query: 116  PDTVVENNQGIKSVDY 131
            P+ V EN +GIK+V Y
Sbjct: 1420 PNVVEENKKGIKAVSY 1435


>gi|312088535|ref|XP_003145899.1| hypothetical protein LOAG_10325 [Loa loa]
 gi|307758937|gb|EFO18171.1| hypothetical protein LOAG_10325 [Loa loa]
          Length = 873

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 20/80 (25%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQ--------RIGVIAQEISKIR 115
           SDRRMK  +  V             +  Y Y  +             R+GVIAQE+++I 
Sbjct: 374 SDRRMKEQIHEVDTKSALSHLAQIRVVGYSYKPEIALKWGLSEENRHRVGVIAQELAEIL 433

Query: 116 PDTVVENNQGIKSVDYGRLF 135
           PD V +N      VD  R+F
Sbjct: 434 PDAVTDNGD-FLQVDDSRIF 452


>gi|167387265|ref|XP_001738089.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165898835|gb|EDR25599.1| hypothetical protein EDI_172560 [Entamoeba dispar SAW760]
          Length = 567

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 38/65 (58%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVANLYQ---------YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD+R K ++K ++N  +         Y+YL+D +  +R G IAQE+ +I P+ V E+  G
Sbjct: 224 SDQRYKKDIKKISNALEKIMLLTGRSYKYLNDKQ--KRFGFIAQELKEIIPEAVKEDEDG 281

Query: 126 IKSVD 130
             S++
Sbjct: 282 TLSIE 286


>gi|121602136|ref|YP_988568.1| hypothetical protein BARBAKC583_0235 [Bartonella bacilliformis
           KC583]
 gi|120614313|gb|ABM44914.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 392

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 49/124 (39%), Gaps = 24/124 (19%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPI-SLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +Q+ QA++ +  L+Q          +    +   P        ++ ++ LS+        
Sbjct: 220 EQENQAWNRLEKLLQAGVASAGNYGTKTGQSTTMP--------SVTKDPLSDAMRWLGLI 271

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIR 115
                        +SD RMK N+ P+       LY++ Y       +  GVIAQ++ ++ 
Sbjct: 272 KGVAG--------LSDVRMKDNIVPIGQKNGYPLYEFNYKG--GAQRYRGVIAQDVLRLN 321

Query: 116 PDTV 119
           PD V
Sbjct: 322 PDAV 325


>gi|225855800|ref|YP_002737311.1| hypothetical protein SPP_0076 [Streptococcus pneumoniae P1031]
 gi|225724622|gb|ACO20474.1| hypothetical protein SPP_0076 [Streptococcus pneumoniae P1031]
          Length = 140

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 16/88 (18%)

Query: 62  DAVNMGYQLAPL--VSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQ 109
           + V  G     +   SDRR+K N+   A           +  + ++ + K  + IG+IAQ
Sbjct: 31  NQVGSGSVKYWMEQKSDRRLKENITDTAVKALDKINRLRMVAFDFI-ENKKHEEIGLIAQ 89

Query: 110 EISKIRPDTVVE---NNQGIKSVDYGRL 134
           E   I P  V     N  G   +DY  L
Sbjct: 90  EAETIVPRIVSRDPENPDGYLHIDYTAL 117


>gi|261879742|ref|ZP_06006169.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270333616|gb|EFA44402.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 204

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 19/82 (23%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYR--------YLSDPKNVQRIGVIAQEISKIR 115
           SD R K N++ + N            Y +          L    + + IG++AQE+ K+ 
Sbjct: 104 SDARAKSNIRSLQNGLNCILKLRPVSYSFSDKPTREASLLRKGGDEREIGLLAQEVEKVL 163

Query: 116 PDTVVENNQGIKSVDYGRLFNI 137
           P+ V+ + +G K ++Y  L  +
Sbjct: 164 PNVVLTDAEGKKLINYTALIPV 185


>gi|326783687|ref|YP_004324081.1| fiber [Synechococcus phage S-SSM7]
 gi|310003699|gb|ADO98094.1| fiber [Synechococcus phage S-SSM7]
          Length = 2328

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 16/93 (17%)

Query: 57   KKEFYDAVNMGYQLAPLVSDRRMKCNVKPV-----------ANLYQYRYLS---DPKNVQ 102
                      G  +    SD R+K N++ +              Y++            +
Sbjct: 2211 NGGSNSLTVSG-DITAFASDMRLKTNIEKIQGAVAKVCKLSGFTYEFNETGRDLKLPAGK 2269

Query: 103  RIGVIAQEISKIRPDTVVENN-QGIKSVDYGRL 134
            ++GV AQ++ +I P+ V         +V Y +L
Sbjct: 2270 QLGVSAQQVQEIFPEAVAVRPIDEYLTVKYEKL 2302


>gi|42524004|ref|NP_969384.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39576212|emb|CAE80377.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1416

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 75   SDRRMKCNV----KPVANLYQYR---YLSDPKNVQRIGVIAQEISKIRPDTVVENN-QGI 126
            SD R+K +V      + NL + R   ++      + +G IAQE+  + P+ V  +   G 
Sbjct: 1280 SDARLKKDVVTLPMALENLLKLRGVNFVWKNNGEKTVGFIAQEVEAVYPELVRTDKVSGF 1339

Query: 127  KSVDYGRLFNI 137
            KSV YG +  I
Sbjct: 1340 KSVQYGNIVAI 1350


>gi|167396255|ref|XP_001741977.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165893173|gb|EDR21513.1| hypothetical protein EDI_289470 [Entamoeba dispar SAW760]
          Length = 561

 Score = 46.3 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 11/65 (16%)

Query: 75  SDRRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SD+R K ++K ++             ++Y+++ +   R G IAQE+ ++  D V E+  G
Sbjct: 219 SDKRSKKDIKRISHALDTICKITGKSFKYVNEDR--TRFGFIAQELKEVITDAVKEDEDG 276

Query: 126 IKSVD 130
             S+D
Sbjct: 277 RFSID 281


>gi|315612415|ref|ZP_07887328.1| phage minor structural protein [Streptococcus sanguinis ATCC 49296]
 gi|315315396|gb|EFU63435.1| phage minor structural protein [Streptococcus sanguinis ATCC 49296]
          Length = 1036

 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 31/75 (41%), Gaps = 17/75 (22%)

Query: 74   VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR---IGVIAQEISKIRPDTVVEN 122
            +SDRR K N++         + NL  Y Y  +          G++AQ++ K  P+   EN
Sbjct: 943  ISDRRYKHNIEASTVSGLAVINNLKTYSYRKEYDGKIEDIACGIMAQDVQKYVPEAFYEN 1002

Query: 123  NQG------IKSVDY 131
              G       + V Y
Sbjct: 1003 PDGAYSYRTFELVPY 1017


>gi|303279701|ref|XP_003059143.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458979|gb|EEH56275.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 723

 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 69  QLAPLVSDRRMKCNVKPVANL-----------YQYRYLSDP----KNVQRIGVIAQEISK 113
            L    SD R K +V+ +              + ++  + P       +++G IAQE+  
Sbjct: 592 GLVSSASDGRYKRDVQNITGALETTRALRAVSFAFQTEAYPEKNFPTERQVGFIAQELEA 651

Query: 114 IRPDTVVENNQGIKSVDYGRL 134
             PD V  ++ G K + Y RL
Sbjct: 652 ALPDVVTTDSDGYKGIAYERL 672


>gi|61805905|ref|YP_214265.1| fiber [Prochlorococcus phage P-SSM2]
 gi|61374414|gb|AAX44411.1| fiber [Prochlorococcus phage P-SSM2]
 gi|265525112|gb|ACY75909.1| predicted protein [Prochlorococcus phage P-SSM2]
          Length = 1908

 Score = 46.3 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 75   SDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKI-RPDTVVEN 122
            SD R+K +VKP+            N + +   S  +  +  GVIAQEIS I  P TV   
Sbjct: 1818 SDARLKNDVKPIQDSLAKVNSISGNTFTWNEASKKEGQEDTGVIAQEISAIGLPGTVTIR 1877

Query: 123  NQGIKSVDYGRL 134
              G  +VDY +L
Sbjct: 1878 EDGTYAVDYEKL 1889


>gi|67476787|ref|XP_653943.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56470945|gb|EAL48556.1| hypothetical protein EHI_105320 [Entamoeba histolytica HM-1:IMSS]
          Length = 678

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R K +++ + N           +Y Y ++P  ++  G IAQE+ +I PD V ++ 
Sbjct: 247 VRSDARSKTDIQTIENALNSVTSLVGKKYAYKNEPNKIKY-GFIAQEVQEIIPDLVQKDE 305

Query: 124 QGIKSVDY 131
               SVDY
Sbjct: 306 TNNLSVDY 313


>gi|148724489|ref|YP_001285455.1| tail fiber [Cyanophage Syn5]
 gi|145588134|gb|ABP87953.1| tail fiber [Synechococcus phage Syn5]
          Length = 1351

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 11/75 (14%)

Query: 72   PLVSDRRMKCNVKPVANLYQ---------YRYLSDPKNV--QRIGVIAQEISKIRPDTVV 120
              +SD  +K N+ P ++ +          Y + ++  N   +++GVIAQ++ +I P  V 
Sbjct: 1250 GALSDINLKENIVPASSQWNNIRDIEIVNYNFKAETGNETNKQLGVIAQQVEEISPGLVN 1309

Query: 121  ENNQGIKSVDYGRLF 135
             + +G+KSV+Y  L+
Sbjct: 1310 TDAEGVKSVNYSVLY 1324


>gi|117924321|ref|YP_864938.1| hypothetical protein Mmc1_1014 [Magnetococcus sp. MC-1]
 gi|117608077|gb|ABK43532.1| hypothetical protein Mmc1_1014 [Magnetococcus sp. MC-1]
          Length = 381

 Score = 45.9 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 3   QKQQAFHEILSLMQNVTVPKLP-ISLNNPTPIAPIDYAGIAQNIYQNQL 50
           Q+ Q  +E+ +++Q     + P     +   +AP D  G  QN Y  Q+
Sbjct: 209 QRTQPMNELSAILQGSPAIQAPSFGAPSQYSVAPADVMGAIQNNYNAQV 257


>gi|183230818|ref|XP_654628.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169802761|gb|EAL49242.2| hypothetical protein EHI_142010 [Entamoeba histolytica HM-1:IMSS]
          Length = 679

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 10/68 (14%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R K +++ + N            Y Y +D  N ++ G +AQ++ KI PD V E++
Sbjct: 235 VRSDARSKTDIEEIHNSLNGILSLVGVSYSYKNDSDN-KKYGFVAQDVQKIYPDLVKEDD 293

Query: 124 QGIKSVDY 131
            G  +VDY
Sbjct: 294 TGKLTVDY 301


>gi|167379710|ref|XP_001735250.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165902849|gb|EDR28569.1| hypothetical protein EDI_338220 [Entamoeba dispar SAW760]
          Length = 679

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R K +++ + N            Y Y  D  N ++ G IAQE+ KI P+ V E++
Sbjct: 235 VRSDARSKTDIEEIHNSLNGILSLVGVSYSYKKDCDN-KKYGFIAQEVQKIYPELVKEDD 293

Query: 124 QGIKSVDY 131
            G  +VDY
Sbjct: 294 TGKLTVDY 301


>gi|257453322|ref|ZP_05618621.1| hypothetical protein F3_09692 [Fusobacterium sp. 3_1_5R]
 gi|317059853|ref|ZP_07924338.1| predicted protein [Fusobacterium sp. 3_1_5R]
 gi|313685529|gb|EFS22364.1| predicted protein [Fusobacterium sp. 3_1_5R]
          Length = 66

 Score = 45.5 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 96  SDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
                 +  GVIAQE+ KI P  V   NQG KSVDY  L  +
Sbjct: 2   WKKNGKKTAGVIAQEVEKILPQAV--QNQGYKSVDYNALVGL 41


>gi|42522455|ref|NP_967835.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39574987|emb|CAE78828.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1148

 Score = 45.5 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 16/71 (22%)

Query: 71   APLVSDRRMKCNVK--------PVANLYQYRYLSDPKNVQRI-------GVIAQEISKIR 115
                SDRR+K ++          +  L   RY     N  ++       G +AQE+  + 
Sbjct: 1011 WTNASDRRLK-DIHGNYEYGLNEILKLRTIRYNYKEGNPLKLPSDVPMTGFVAQEVQAVI 1069

Query: 116  PDTVVENNQGI 126
            PD V +   G 
Sbjct: 1070 PDAVKKREDGY 1080


>gi|85059214|ref|YP_454916.1| hypothetical protein SG1235 [Sodalis glossinidius str. 'morsitans']
 gi|84779734|dbj|BAE74511.1| hypothetical protein [Sodalis glossinidius str. 'morsitans']
          Length = 313

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 58/162 (35%), Gaps = 32/162 (19%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQL--SERKEGKKEFYDAVNMGYQL--- 70
                       N  T     D   I  + ++++L  ++  + K   +      Y +   
Sbjct: 141 SASLQYNPYAGGNMRTEFYSTD---IINDHFEHRLILAKSNDLKWFVFKDDGSAYAMQGH 197

Query: 71  APLVSDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
               SDRR+K +++        V  L  Y Y+      ++ GV+A E+ K+ P+ V  + 
Sbjct: 198 WQNNSDRRIKSDIEKIENGLEKVETLTGYTYVLAEH--RQAGVMADELEKVLPEAVGNSG 255

Query: 124 Q----------GIKSVDYGRLF-----NIGQIQTKQKKNTAQ 150
                       +KSV YG +       I  +  K K   A+
Sbjct: 256 DYHESDGTVVKNVKSVAYGSITALLIEAIKDLSAKVKAQQAE 297


>gi|124004568|ref|ZP_01689413.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123990140|gb|EAY29654.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 341

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 38/100 (38%), Gaps = 36/100 (36%)

Query: 71  APLVSDRRMKCNVKPV-----------ANLYQYRYLSDPKN------------------- 100
               SD+R+K N+ P+              YQY +  +                      
Sbjct: 112 WYTTSDKRLKSNINPIEGSLTKLLQLKGVSYQYTFELNKYGDLSGEKITEIKQKTIDADK 171

Query: 101 ------VQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
                  QR+G IAQ++ ++ P+ V ++ +G  SV+Y  +
Sbjct: 172 PYTSKAKQRLGFIAQDLQQVLPEAVAKDEKGFLSVNYSEV 211


>gi|324500951|gb|ADY40431.1| Myelin gene regulatory factor [Ascaris suum]
          Length = 992

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 49/149 (32%), Gaps = 28/149 (18%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
           ++Q     K+ +  +NP    P D     Q                   A+        +
Sbjct: 449 VVQAYQSEKVIVRASNPGQFEPPDSDVAWQKNGSTLFYNSGSVAIGMDRAMAPLTVGGDI 508

Query: 74  V--------SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQ--------RIGV 106
                    SDRR+K  +  V             +  Y Y  +             R+GV
Sbjct: 509 YCSGVVHRPSDRRVKEEIHEVDTKDAMSRLAQIRVVGYSYKPEIALQWGLSEENRHRVGV 568

Query: 107 IAQEISKIRPDTVVENNQGIKSVDYGRLF 135
           IAQE+++I PD V +N      VD  R+F
Sbjct: 569 IAQELAEILPDAVTDNGD-FLQVDDSRIF 596


>gi|53802955|ref|YP_115302.1| hypothetical protein MCA2909 [Methylococcus capsulatus str. Bath]
 gi|53756716|gb|AAU91007.1| hypothetical protein MCA2909 [Methylococcus capsulatus str. Bath]
          Length = 492

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/191 (16%), Positives = 54/191 (28%), Gaps = 63/191 (32%)

Query: 7   AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYA---------------GIAQNIYQNQLS 51
             + I     +        S    T +A  D+                G A N +     
Sbjct: 280 PANAITGFGSSAQALAATQSAGAATTVARSDHRHPYPTAAQVGAAATYGDAANQFNADFF 339

Query: 52  ERKEGKK------------------------EFYDAVNMGYQLAP-------LVSDRRMK 80
           +  +                             +   N     AP       + S+RR+K
Sbjct: 340 QATQDVGYRFANSPGSYAMTSTDGGVRVPVGGGFHVRNTSLAYAPCYASAFTVSSNRRLK 399

Query: 81  C-------NVKPVANLYQYRYLSDPKNVQ---RIGVIAQEISKIRPDTV------VENNQ 124
                    ++ V  L   RY  +    Q    +G+IA++  ++ P+ V           
Sbjct: 400 RVLGEVRHALERVRALQPIRYRLEADGPQGRIELGLIAEDAREVLPEVVYPVTDGANGPD 459

Query: 125 GIK-SVDYGRL 134
           G   S+DYGRL
Sbjct: 460 GASLSIDYGRL 470


>gi|167376221|ref|XP_001733910.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904804|gb|EDR29951.1| hypothetical protein EDI_007940 [Entamoeba dispar SAW760]
          Length = 298

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R K +++ + N            Y Y  D  N ++ G IAQE+ KI P+ V E++
Sbjct: 229 VRSDARSKTDIEEIHNSLNGILSLVGVSYSYKKDCDN-KKYGFIAQEVQKIYPELVKEDD 287

Query: 124 QGIKSVDY 131
            G  +VDY
Sbjct: 288 TGKLTVDY 295


>gi|158300805|ref|XP_320635.4| AGAP011890-PA [Anopheles gambiae str. PEST]
 gi|157013338|gb|EAA00097.4| AGAP011890-PA [Anopheles gambiae str. PEST]
          Length = 352

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 42/113 (37%), Gaps = 8/113 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   N    I+P   A I    Y     E K+  +   D +     + P   ++R+   
Sbjct: 216 PPFYSNQGLAISPGMKARIRTGQYDFPNPEWKKVSQAAKDLIKDMLNVEP---EKRL--T 270

Query: 83  VKPVA-NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYG 132
           ++ V  N +  RY   P+     G + +E  +I P+    +  +     VDY 
Sbjct: 271 IEQVMMNPWIRRYTEVPQTPLHTGRMLKEGEEIWPEVQEEMTRSLANMRVDYE 323


>gi|124002007|ref|ZP_01686861.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
 gi|123992473|gb|EAY31818.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
          Length = 609

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 30/147 (20%), Positives = 52/147 (35%), Gaps = 25/147 (17%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYA------GIAQNIYQNQLSERKEGKKEFYD 62
           +EIL L   +       +       A   Y       G+ +  +    +    G   +  
Sbjct: 414 NEILRL-DGLYASGNAPATKVSFGGAGTRYGAVWWVPGLNEFQFTQSTNNWFGGAGYYAS 472

Query: 63  AVNMGYQLAP--LVSDRRMKCNVKPV------------ANLYQYRYLSDPKN----VQRI 104
                       L SD R K ++ P+             N YQ+R             ++
Sbjct: 473 IRGNAIYSNSTQLTSDIRFKKDIMPITHEVIAKLGQLQGNTYQWRTEEFKNRDFAEGTQL 532

Query: 105 GVIAQEISKIRPDTVVENNQGIKSVDY 131
           G IAQE+ ++ P+ V E++QG  S++Y
Sbjct: 533 GFIAQEMQEVYPELVNEDHQGDLSINY 559


>gi|92119290|ref|YP_579019.1| hypothetical protein Nham_3856 [Nitrobacter hamburgensis X14]
 gi|91802184|gb|ABE64559.1| hypothetical protein Nham_3856 [Nitrobacter hamburgensis X14]
          Length = 461

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 36/93 (38%), Gaps = 16/93 (17%)

Query: 58  KEFYDAVNMGYQLAPLVSDRRMKCNVK------PVANLYQYRYLSDPKNVQRIGVIAQEI 111
                 ++ G       SD R+K N++       +      ++         +GVIAQE+
Sbjct: 324 GSSGVYLSQGATSWSASSDIRLKKNIETLRVLDRLDGYRAVQFNWKQSGKHDLGVIAQEL 383

Query: 112 SKIRPDTVVENNQ----------GIKSVDYGRL 134
            KI P+ V + +           G+ SV Y +L
Sbjct: 384 YKIFPEVVNKGSDSGTVEKMNDKGVWSVQYDKL 416


>gi|303288387|ref|XP_003063482.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226455314|gb|EEH52618.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 470

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 17/77 (22%)

Query: 75  SDRRMKCNVKPVANL-------------YQYRYLSDP----KNVQRIGVIAQEISKIRPD 117
           SD R K +V+ +                + +   + P        +IG IAQE+ ++ P+
Sbjct: 354 SDERFKRDVRALDETLDALREEDVRPVTFNFDAEAHPTKVFPEGPQIGFIAQELERVLPN 413

Query: 118 TVVENNQGIKSVDYGRL 134
            V     G KSV Y R+
Sbjct: 414 LVHTGADGFKSVAYDRV 430


>gi|163868964|ref|YP_001610193.1| hypothetical protein Btr_1966 [Bartonella tribocorum CIP 105476]
 gi|161018640|emb|CAK02198.1| hypothetical protein BT_1966 [Bartonella tribocorum CIP 105476]
          Length = 379

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 8/65 (12%)

Query: 76  DRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ-GIKSV 129
           D R K N+ P+       LY + Y  +P+  Q  GV+AQ++ +++P+ V  N +  +  V
Sbjct: 278 DVRAKENIIPMGKKKGYPLYTFNYKGNPQRYQ--GVLAQDVLRVKPEAVFINAKTKLLHV 335

Query: 130 DYGRL 134
           DY ++
Sbjct: 336 DYDKI 340


>gi|260432545|ref|ZP_05786516.1| hypothetical protein SL1157_1676 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416373|gb|EEX09632.1| hypothetical protein SL1157_1676 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 441

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 10/69 (14%)

Query: 75  SDRRMKCNVKPVAN-------LYQYRYLSDPKNV-QRIGVIAQEISKIRPDTV--VENNQ 124
           SDR +K N+ P  +       L   ++           GVIAQ++ ++ PD V     + 
Sbjct: 351 SDRALKENIAPAGDAGAIIDALEVVQHDWIANGAHTSFGVIAQDVHEVFPDAVSPASEDT 410

Query: 125 GIKSVDYGR 133
               VDY R
Sbjct: 411 EFWMVDYSR 419


>gi|300949468|ref|ZP_07163467.1| conserved domain protein [Escherichia coli MS 116-1]
 gi|300451118|gb|EFK14738.1| conserved domain protein [Escherichia coli MS 116-1]
          Length = 168

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 74  VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
            SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V
Sbjct: 24  SSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAV 76


>gi|85716604|ref|ZP_01047574.1| putative membrane-anchored cell surface protein [Nitrobacter sp.
           Nb-311A]
 gi|85696605|gb|EAQ34493.1| putative membrane-anchored cell surface protein [Nitrobacter sp.
           Nb-311A]
          Length = 684

 Score = 43.9 bits (102), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/108 (24%), Positives = 38/108 (35%), Gaps = 15/108 (13%)

Query: 39  AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA--------NLY 90
           +G+       QL  R        +    G   A   SD R+K                L+
Sbjct: 536 SGMVSGN-SFQLFYRNGSVVGDINYNGTGVTYATT-SDERLKTKFDKSGIDWGRRLDELW 593

Query: 91  Q--YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK--SVDYGRL 134
              Y + S P     +GV AQ   K+ P  V + +      +VDYG+L
Sbjct: 594 VGDYEFKSRPGVTM-LGVTAQRTEKVFPQAVHKPSSEGDVWTVDYGQL 640


>gi|109290197|ref|YP_656446.1| gp36 small distal tail fiber subunit [Aeromonas phage 25]
 gi|104345870|gb|ABF72770.1| gp36 small distal tail fiber subunit [Aeromonas phage 25]
          Length = 1305

 Score = 43.9 bits (102), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 12/69 (17%)

Query: 72   PLVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
             + SDRR+K N K +             +Y  + L D   V  +G+IAQ + K++P +V 
Sbjct: 1212 NVTSDRRLKSNFKAIDNPLSKVEQLTGQIYD-KKLKDGGIVSEVGLIAQHVQKVQPMSVR 1270

Query: 121  ENNQGIKSV 129
            E + G+ S+
Sbjct: 1271 EGDDGMLSI 1279


>gi|310722234|ref|YP_003969058.1| small distal tail fiber subunit [Aeromonas phage phiAS4]
 gi|306021077|gb|ADM79612.1| small distal tail fiber subunit [Aeromonas phage phiAS4]
          Length = 907

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 13/65 (20%)

Query: 73  LVSDRRMKCN-------VKPVANLYQYRYLSD------PKNVQRIGVIAQEISKIRPDTV 119
           + SDRR+K N       ++ V+ L  Y Y           + + +G+IAQ++ ++ P+ V
Sbjct: 803 IRSDRRLKKNFVEVRDALRKVSALTAYSYDKKQTLEATEYDKKEVGLIAQDVEQVLPEAV 862

Query: 120 VENNQ 124
                
Sbjct: 863 TRVVD 867


>gi|167391385|ref|XP_001739752.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165896455|gb|EDR23863.1| hypothetical protein EDI_016550 [Entamoeba dispar SAW760]
          Length = 492

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 47/128 (36%), Gaps = 15/128 (11%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
             L   +   K   +      IAP+           N+  +R     E +       +  
Sbjct: 87  TGLADTIESTKEIENNYQIISIAPLCNEDFITIQSVNKNIKRLCIAGELFSEAGFFQR-- 144

Query: 72  PLVSDRRMKCNVKPVANL---------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
              SD++ K  ++ +            Y + Y +D  N Q+ G +AQE+ +I P+TV   
Sbjct: 145 ---SDQKNKNEIQKITGALEQLKNVVGYSFVYKNDENN-QKYGFMAQELQEIYPNTVKVL 200

Query: 123 NQGIKSVD 130
             G  S+D
Sbjct: 201 PDGTLSID 208


>gi|42524565|ref|NP_969945.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
           HD100]
 gi|39576774|emb|CAE80938.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
           HD100]
          Length = 922

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 27/70 (38%), Gaps = 14/70 (20%)

Query: 71  APLVSDRRMKC-------NVKPVANLYQYRYLSDPKNVQRI-------GVIAQEISKIRP 116
             + SD R+K         +  +  L+  RY     N  +I       G IAQE+ ++ P
Sbjct: 778 WTVASDARLKDVHGDYEFGLSEILKLHTVRYNYKKDNAAKIPSDVPMVGFIAQEVQQVIP 837

Query: 117 DTVVENNQGI 126
           D V     G 
Sbjct: 838 DAVKTRADGY 847


>gi|316973175|gb|EFV56795.1| NDT80 / PhoG like DNA-binding family protein [Trichinella spiralis]
          Length = 914

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 20/80 (25%)

Query: 75  SDRRMKCNVKPV---------ANLYQYRYLSDPK----------NVQRIGVIAQEISKIR 115
           SD R+K N+K V         + +   +Y   P+          + QR+GVIAQE++ + 
Sbjct: 473 SDARLKQNIKEVNCAEALSRLSQIRIVQYEIRPEVSQQWQLPAEDCQRVGVIAQEVNDVL 532

Query: 116 PDTVVENNQGIKSVDYGRLF 135
           PD V  N +   +VD  R+F
Sbjct: 533 PDAVKSNGE-FLTVDDSRIF 551


>gi|155122204|gb|ABT14072.1| hypothetical protein MT325_M518L [Paramecium bursaria chlorella virus
            MT325]
          Length = 1189

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 41/99 (41%), Gaps = 19/99 (19%)

Query: 67   GYQLAPLVSDRRMKCNVK-----------PVANLYQYRYLSD--PKNVQRIGVIAQEISK 113
            G  L    SDRR+K ++               +L ++ +       +  ++G IAQE+ +
Sbjct: 1077 GGGLWTATSDRRLKNDITTANIDRCEEIVRSLDLKKFTWADQVRENDRNQLGWIAQEVEE 1136

Query: 114  IRPDTVVENN----QGIKSVDYGRLFNI--GQIQTKQKK 146
            + P  VVE      +  K VD  +L     G +Q   ++
Sbjct: 1137 VFPKAVVEKEMFGLENCKMVDGSQLLMAMYGALQKCIRR 1175


>gi|315252835|gb|EFU32803.1| conserved domain protein [Escherichia coli MS 85-1]
          Length = 625

 Score = 43.6 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 74  VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
            SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V
Sbjct: 481 SSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAV 533


>gi|313157451|gb|EFR56872.1| conserved hypothetical protein [Alistipes sp. HGB5]
          Length = 221

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNV 101
           A+N+Y N  +  K   +    A     QL P+  +   K +    +     R  +   N 
Sbjct: 105 ARNVYTNSDAASKTNIQSLGSATATLTQLRPVSFEWADKAHYFKTS-----RRSTGVSNP 159

Query: 102 QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF 135
           + +G IAQEI ++ PD V  + +G + V+Y  L 
Sbjct: 160 KEMGFIAQEIEQVLPDIVAVDCEGHRVVNYSALI 193


>gi|291514530|emb|CBK63740.1| hypothetical protein AL1_12670 [Alistipes shahii WAL 8301]
          Length = 174

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNV 101
           A+N+Y N  +  K   +    A     QL P+  +   K +    +     R  +   N 
Sbjct: 58  ARNVYTNSDAASKTNIQSLGSATATLTQLRPVSFEWADKAHYFKTS-----RRSTGVSNP 112

Query: 102 QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF 135
           + +G IAQEI ++ PD V  + +G + V+Y  L 
Sbjct: 113 KEMGFIAQEIEQVLPDIVAVDCEGHRVVNYSALI 146


>gi|300955526|ref|ZP_07167889.1| prophage tail fibre [Escherichia coli MS 175-1]
 gi|300317582|gb|EFJ67366.1| prophage tail fibre [Escherichia coli MS 175-1]
          Length = 1261

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 74   VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
             SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V
Sbjct: 1117 SSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAV 1169


>gi|301305885|ref|ZP_07211969.1| conserved domain protein [Escherichia coli MS 124-1]
 gi|300838890|gb|EFK66650.1| conserved domain protein [Escherichia coli MS 124-1]
          Length = 801

 Score = 43.6 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 74  VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
            SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V
Sbjct: 657 SSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAV 709


>gi|300902064|ref|ZP_07120080.1| hypothetical protein HMPREF9536_00268 [Escherichia coli MS 84-1]
 gi|300405828|gb|EFJ89366.1| hypothetical protein HMPREF9536_00268 [Escherichia coli MS 84-1]
          Length = 317

 Score = 43.2 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 74  VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
            SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V
Sbjct: 228 SSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAV 280


>gi|315252540|gb|EFU32508.1| conserved hypothetical protein [Escherichia coli MS 85-1]
          Length = 265

 Score = 43.2 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 74  VSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
            SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V
Sbjct: 121 SSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAV 173


>gi|155371439|ref|YP_001426973.1| hypothetical protein ATCV1_Z492L [Acanthocystis turfacea Chlorella
            virus 1]
 gi|155124759|gb|ABT16626.1| hypothetical protein ATCV1_Z492L [Acanthocystis turfacea Chlorella
            virus 1]
          Length = 1301

 Score = 43.2 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 31/75 (41%), Gaps = 14/75 (18%)

Query: 62   DAVNMGYQLAPLVSDRRMKCNVKP---------VANLYQYRYLSD-----PKNVQRIGVI 107
            +A   G       SDRR+K ++           V +L   R+  D       +  +IG I
Sbjct: 1177 NAFKPGGGSWTATSDRRLKNDITLANSIVCENLVRSLPLKRFTWDNMVPTGGDKNQIGFI 1236

Query: 108  AQEISKIRPDTVVEN 122
            AQ++ +  P +VV  
Sbjct: 1237 AQDVEQFMPKSVVTR 1251


>gi|329917056|ref|ZP_08276427.1| Putative membrane-anchored cell surface protein [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327544636|gb|EGF30101.1| Putative membrane-anchored cell surface protein [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 227

 Score = 43.2 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 86  VANLYQYRYLSDPKNV----QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
               Y++   + PK      +++G IAQ+I +  P+ V  + +G KSV Y +L
Sbjct: 12  QGVHYEFDRAAFPKKGFEAGRQLGFIAQQIEQFVPEVVRTDAEGYKSVQYSQL 64


>gi|155370623|ref|YP_001426157.1| hypothetical protein FR483_N525L [Paramecium bursaria Chlorella virus
            FR483]
 gi|155123943|gb|ABT15810.1| hypothetical protein FR483_N525L [Paramecium bursaria Chlorella virus
            FR483]
          Length = 1321

 Score = 43.2 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 41/99 (41%), Gaps = 19/99 (19%)

Query: 67   GYQLAPLVSDRRMKCNVK-----------PVANLYQYRYLSD--PKNVQRIGVIAQEISK 113
            G  L    SDRR+K ++               +L ++ +       +  ++G IAQE+ +
Sbjct: 1209 GGGLWTATSDRRLKNDITTANIDRCEEIVRSLDLKKFTWADQVRENDRNQLGWIAQEVEE 1268

Query: 114  IRPDTVVENN----QGIKSVDYGRLFNI--GQIQTKQKK 146
            + P  VVE      +  K VD  +L     G +Q   ++
Sbjct: 1269 VFPKAVVEKEMFGLENCKMVDGSQLLMAMYGALQKCIRR 1307


>gi|260826928|ref|XP_002608417.1| hypothetical protein BRAFLDRAFT_137080 [Branchiostoma floridae]
 gi|229293768|gb|EEN64427.1| hypothetical protein BRAFLDRAFT_137080 [Branchiostoma floridae]
          Length = 348

 Score = 42.8 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 17/70 (24%)

Query: 75  SDRRMKCNVKP---------VANLYQYRYLSDPKNVQRIG--------VIAQEISKIRPD 117
           SD R K N+K          V+ L  Y Y   P+  +++G        V+AQE+ ++ PD
Sbjct: 209 SDMRAKENIKEADTKEALTNVSQLKVYNYNYKPEFAEKMGIDKVDDKGVLAQEVKEVIPD 268

Query: 118 TVVENNQGIK 127
            V+E  + I 
Sbjct: 269 AVIETGEDID 278


>gi|299779191|ref|YP_003734385.1| gp37 long tail fiber distal subunit [Enterobacteria phage IME08]
 gi|281312973|gb|ADA59471.1| receptor-recognizing protein gp37 [Escherichia phage IME08]
 gi|298105920|gb|ADI55564.1| gp37 long tail fiber distal subunit [Enterobacteria phage IME08]
          Length = 1289

 Score = 42.8 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 46/128 (35%), Gaps = 22/128 (17%)

Query: 19   TVPKLPISLNNPTPIAPIDY----AGIAQN------IYQNQLSERKEGKKEFYDAVNMGY 68
                  ++  N    + I +     GI QN      IY N +   +    + Y   N+  
Sbjct: 1125 QTSAFGVNTTNSLGGSSITFGDSDTGIKQNGDGLLDIYANNIQVFRFQNGDLYSYKNINA 1184

Query: 69   QLAPLVSDRRMKCNVKPV-----------ANLY-QYRYLSDPKNVQRIGVIAQEISKIRP 116
                + SD R+K N +P+             +Y +  Y+         GVIAQ + ++ P
Sbjct: 1185 PNVYIRSDIRLKSNFRPIENALEKVEQLDGLIYDKAEYIGGEAVQTEAGVIAQSLEEVLP 1244

Query: 117  DTVVENNQ 124
            + + E   
Sbjct: 1245 EAICEAED 1252


>gi|124002006|ref|ZP_01686860.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
 gi|123992472|gb|EAY31817.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
          Length = 502

 Score = 42.8 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 16/80 (20%)

Query: 74  VSDRRMKCNVKPV--------ANLY--QYRYLSDPKN------VQRIGVIAQEISKIRPD 117
            SD R K ++ P+          L    +++ ++           +IG IAQE+  + P+
Sbjct: 390 SSDLRFKKDITPITSEAITKLGQLQGKTFQWRTEEFKEKNFSEGTKIGFIAQEMLNVYPE 449

Query: 118 TVVENNQGIKSVDYGRLFNI 137
            V E   G  S++Y  L  I
Sbjct: 450 LVNEGGDGYYSINYSGLIPI 469


>gi|307105763|gb|EFN54011.1| hypothetical protein CHLNCDRAFT_58365 [Chlorella variabilis]
          Length = 1346

 Score = 42.8 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 43/110 (39%), Gaps = 24/110 (21%)

Query: 44  NIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV------------ANLYQ 91
             Y  +    +   +   D    G    P+VSD  MK  V+                 Y 
Sbjct: 362 GEYAGKALVVQGDAQVLGDMTVRGL---PVVSDASMKEGVRAFEQGEKAVAIAAEITTYL 418

Query: 92  YRYLSDPKNVQRIGVIAQEISKIRP-------DTVVENNQGIKSVDYGRL 134
           YRY     + QR+GV+AQ++  +         + V ++ QG  SVDYG L
Sbjct: 419 YRYKGT--DAQRLGVVAQQVRAVLEQHGATDMNLVRQDPQGALSVDYGGL 466


>gi|330004342|ref|ZP_08304900.1| hypothetical protein HMPREF9538_02582 [Klebsiella sp. MS 92-3]
 gi|328536714|gb|EGF63036.1| hypothetical protein HMPREF9538_02582 [Klebsiella sp. MS 92-3]
          Length = 513

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 27/82 (32%), Gaps = 11/82 (13%)

Query: 46  YQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ-----------YRY 94
           Y   +                G       SD+  K ++KP   L             + Y
Sbjct: 359 YGAAVQYWHHRSDGMIWNSQRGDVAWAATSDKNFKRDIKPTDGLQSLQNINAMDLVTFIY 418

Query: 95  LSDPKNVQRIGVIAQEISKIRP 116
             D +   R GVIAQ+I KI P
Sbjct: 419 NDDERQRLRRGVIAQQIQKIDP 440


>gi|309364934|emb|CAP23547.2| CBR-PQN-47 protein [Caenorhabditis briggsae AF16]
          Length = 925

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 20/89 (22%)

Query: 75  SDRRMKCNV------KPVANLYQ-----YRYLSDPKNVQ--------RIGVIAQEISKIR 115
           SD R+K  +      + + NL +     YRY  +  NV         R G+IAQE+  + 
Sbjct: 464 SDIRLKEGISEKETAEAIENLLKLRVVDYRYKDEVANVWGLDEQQRQRTGLIAQELQAVL 523

Query: 116 PDTVVENNQGIKSVDYGRLFNIGQIQTKQ 144
           PD V  +     ++D GR+F    + T+Q
Sbjct: 524 PDAV-RDIGDYLTIDEGRVFYETVMATQQ 551


>gi|38640257|ref|NP_944213.1| hypothetical protein Aeh1p335 [Aeromonas phage Aeh1]
 gi|33414942|gb|AAQ17985.1| hypothetical protein Aeh1ORF316w [Aeromonas phage Aeh1]
          Length = 1358

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 35/91 (38%), Gaps = 9/91 (9%)

Query: 57   KKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQ 109
                    N  +    + SD R+K N KP+ N       L    Y    K  +  G+IAQ
Sbjct: 1244 AGGMKAEGNGSFNDVQIRSDERLKSNFKPILNALDKVDTLSGLTYDKVGKTTREAGIIAQ 1303

Query: 110  EISKIRPDTVVENNQGIK--SVDYGRLFNIG 138
            ++  + P+        +   +++Y  + N G
Sbjct: 1304 KLKAVLPEATGTVLNAMDPTAIEYLTVSNSG 1334


>gi|268532300|ref|XP_002631278.1| C. briggsae CBR-PQN-47 protein [Caenorhabditis briggsae]
          Length = 918

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 20/89 (22%)

Query: 75  SDRRMKCNV------KPVANLYQ-----YRYLSDPKNVQ--------RIGVIAQEISKIR 115
           SD R+K  +      + + NL +     YRY  +  NV         R G+IAQE+  + 
Sbjct: 474 SDIRLKEGISEKETAEAIENLLKLRVVDYRYKDEVANVWGLDEQQRQRTGLIAQELQAVL 533

Query: 116 PDTVVENNQGIKSVDYGRLFNIGQIQTKQ 144
           PD V  +     ++D GR+F    + T+Q
Sbjct: 534 PDAV-RDIGDYLTIDEGRVFYETVMATQQ 561


>gi|94967385|ref|YP_589433.1| hypothetical protein Acid345_0354 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549435|gb|ABF39359.1| hypothetical protein Acid345_0354 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 689

 Score = 42.0 bits (97), Expect = 0.024,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 37/92 (40%), Gaps = 13/92 (14%)

Query: 46  YQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV------------KPVANLYQYR 93
           Y   +     G       +    +L    S RR K  +            +PV   Y+  
Sbjct: 532 YIAGIYSESPGPSSASVVIGSNGKLGIPTSSRRFKEQIADIGDSRKLFQLRPVTFFYKPE 591

Query: 94  YLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           Y     + ++ G+IA+E++KI PD V+ + +G
Sbjct: 592 YDG-GAHEKQFGLIAEEVAKIYPDMVINDKEG 622


>gi|116748330|ref|YP_845017.1| hypothetical protein Sfum_0885 [Syntrophobacter fumaroxidans MPOB]
 gi|116697394|gb|ABK16582.1| conserved hypothetical protein [Syntrophobacter fumaroxidans MPOB]
          Length = 428

 Score = 42.0 bits (97), Expect = 0.024,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 69  QLAPLVSDRRMKCNVKPVA----NLYQ-----YRYLSDPKNVQRIGVIAQEISKIRPDTV 119
           QL    S  R K ++ P+     +L+Q     + Y  + + +   G+IA+E++ + P+ V
Sbjct: 271 QLGIKASSARYKTDIAPLGERSDSLHQLRPVTFHYKEEARGLPEYGLIAEEVAVVYPELV 330

Query: 120 VENNQG 125
             + +G
Sbjct: 331 TRDPRG 336


>gi|328870631|gb|EGG19004.1| NDT80/PhoG-like protein [Dictyostelium fasciculatum]
          Length = 1081

 Score = 42.0 bits (97), Expect = 0.024,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 47/125 (37%), Gaps = 31/125 (24%)

Query: 51  SERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-----------LYQYRYLSDPK 99
           +E  E      +    G    P  SDRR+K ++KPV             LY Y+      
Sbjct: 774 AEPNEALSVHGNIAVTGTTYNP--SDRRVKKDIKPVNTKEQLEKIKKLQLYDYQLTDQWA 831

Query: 100 N------VQRIGVIAQEISKIRPDTVVEN-----NQG-----IKSVDYGRLF--NIGQIQ 141
                   +  GV+AQE+ ++ P+ V E      + G        V+   +F  N+G  Q
Sbjct: 832 KDTGITEKKERGVLAQELREVIPNAVKETGDRELSDGTVLKDFLMVNKDAIFMENVGATQ 891

Query: 142 TKQKK 146
              KK
Sbjct: 892 ELSKK 896


>gi|308509976|ref|XP_003117171.1| CRE-PQN-47 protein [Caenorhabditis remanei]
 gi|308242085|gb|EFO86037.1| CRE-PQN-47 protein [Caenorhabditis remanei]
          Length = 932

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 20/89 (22%)

Query: 75  SDRRMKCNV------KPVANLYQ-----YRYLSDPKNVQ--------RIGVIAQEISKIR 115
           SD R+K  +      + + NL +     YRY S+  +V         R G+IAQE+  + 
Sbjct: 474 SDIRLKEGISEKETAEAIENLLKLRVVDYRYKSEVADVWGLDEQQRQRTGLIAQELQAVL 533

Query: 116 PDTVVENNQGIKSVDYGRLFNIGQIQTKQ 144
           PD V  +     ++D GR+F    + T+Q
Sbjct: 534 PDAV-RDIGDYLTIDEGRVFYETVMATQQ 561


>gi|50952803|gb|AAT90328.1| klebicin D phage-associated protein [Klebsiella oxytoca]
          Length = 377

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 32/84 (38%), Gaps = 17/84 (20%)

Query: 53  RKEGKKEFYDAVNMGYQL----APLVSDRRMKCNVKPVANL---------YQYRYLSDPK 99
              G + +Y+  N G+          SD RMK +++ + N          Y Y     P 
Sbjct: 245 ANGGAQGWYEFRNDGHAYTNGAWNSSSDARMKTDIEKIDNALDRLDRIGGYTYLKQGKP- 303

Query: 100 NVQRIGVIAQEISKIRPDTVVENN 123
                GVIAQE+  + P  V +  
Sbjct: 304 ---EAGVIAQEVETVLPQAVTQTA 324


>gi|183232159|ref|XP_653936.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169802174|gb|EAL48549.2| hypothetical protein EHI_105260 [Entamoeba histolytica HM-1:IMSS]
          Length = 675

 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 12/68 (17%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R KC+++P+++           QYRY + P+   R+G +AQE+ ++ PD V  + 
Sbjct: 293 VRSDERTKCHIRPLSDCLESISQLVGKQYRYKNSPQL--RLGFVAQEVKEVLPDLVHTDE 350

Query: 124 -QGIKSVD 130
             G  SVD
Sbjct: 351 ITGTLSVD 358


>gi|119386796|ref|YP_917851.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
 gi|119377391|gb|ABL72155.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
          Length = 716

 Score = 42.0 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 8/70 (11%)

Query: 72  PLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVV--ENN 123
              SD R+K +++    L        + Y     + +  GVIAQ+ + I P  +   E  
Sbjct: 620 NTSSDGRLKTDLQEFDGLGTINALEVWDYEWVNGSGRGRGVIAQDAALIAPYALTPGETP 679

Query: 124 QGIKSVDYGR 133
             + S DY +
Sbjct: 680 DEMWSADYSK 689


>gi|167377044|ref|XP_001734263.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904344|gb|EDR29586.1| hypothetical protein EDI_210610 [Entamoeba dispar SAW760]
          Length = 585

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 12/68 (17%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD R KC+++P+++           QYRY + P+   R+G +AQE+ +I PD V  + 
Sbjct: 203 VRSDERTKCHIRPLSDCLESISQLVGKQYRYKNSPQL--RLGFVAQEVKEILPDLVHTDE 260

Query: 124 -QGIKSVD 130
             G  SVD
Sbjct: 261 ITGTLSVD 268


>gi|298376506|ref|ZP_06986461.1| carbohydrate binding domain-containing protein [Bacteroides sp.
            3_1_19]
 gi|298266384|gb|EFI08042.1| carbohydrate binding domain-containing protein [Bacteroides sp.
            3_1_19]
          Length = 1242

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 49/134 (36%), Gaps = 20/134 (14%)

Query: 17   NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
                P L + ++N   I   +  G   N+Y N+ +              +        SD
Sbjct: 1090 GGRYPFLGVRIDNGNGIYGWNSPGNIANLYINKDAASTAHVY-------ITNYQGLTSSD 1142

Query: 77   RRMKC---NVKPVA----NLYQYRY--LSDPKNVQRIGVIAQEISKIRPDTV----VENN 123
             R+K    ++  V      +  + Y    D   + RIGV AQ + ++ P+ V     +++
Sbjct: 1143 IRLKSVFFDIPDVLDKLEGISAFYYTMKEDEDKILRIGVSAQAVREVLPEAVHLITPDDD 1202

Query: 124  QGIKSVDYGRLFNI 137
                 VDY ++   
Sbjct: 1203 DSYYGVDYIQMLTA 1216


>gi|90415840|ref|ZP_01223773.1| putative outer membrane protein [marine gamma proteobacterium
            HTCC2207]
 gi|90332214|gb|EAS47411.1| putative outer membrane protein [marine gamma proteobacterium
            HTCC2207]
          Length = 1157

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 54   KEGKKEFYDAVNMGYQLAPL---VSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
            + G     + V  G  LA +    SDRR+K ++         +  L    Y     N++R
Sbjct: 1027 QLGNASVTNVVTSGRLLADMYLIASDRRLKKDIVDTRYGLNTILELRPVDYKVKSNNLER 1086

Query: 104  IGVIAQEISKIRPDTV 119
            IG IAQE+  I P+ V
Sbjct: 1087 IGFIAQELRPIVPEVV 1102


>gi|320198066|gb|EFW72674.1| Phage tail fiber protein [Escherichia coli EC4100B]
          Length = 519

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 40/123 (32%), Gaps = 16/123 (13%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD----AVNMGYQLAP 72
            V  P  P     P         G       N  ++ +              N  +    
Sbjct: 362 GVAGPAGPAGPQGPKGDTGAPGQGTELLTTANTWTQAQTFNGGINGNLTVTGNGSFNDIQ 421

Query: 73  LVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
           + SD+R K N+  +             LY+ +Y +D      +G+IAQ+  K  P+ V E
Sbjct: 422 IRSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSADGWQTS-VGLIAQDAQKALPELVTE 480

Query: 122 NNQ 124
           +  
Sbjct: 481 DAD 483


>gi|3915245|sp|Q38394|VG37_BPK3 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
            AltName: Full=Receptor-recognizing protein
 gi|15111|emb|CAA28445.1| unnamed protein product [Enterobacteria phage K3]
          Length = 1243

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 43/128 (33%), Gaps = 19/128 (14%)

Query: 15   MQNVTVPKLPISLNNPTPIAPIDYAGIAQN------IYQNQLSERKEGKKEFYDAVNMGY 68
            M +  V        N       D  GI QN      IY N     +    + Y   N+  
Sbjct: 1080 MNSFGVNTSNALGGNSITFGDTD-TGIKQNGDGLLDIYANNAQVFRFQNGDLYSYKNINA 1138

Query: 69   QLAPLVSDRRMKCNVKPV-----------ANLY-QYRYLSDPKNVQRIGVIAQEISKIRP 116
                + SD R+K N KP+             +Y +  Y+         G++AQ +  + P
Sbjct: 1139 PNVYIRSDIRLKSNFKPIENALDKVEKLNGVIYDKAEYIGGEAIETEAGIVAQTLQDVLP 1198

Query: 117  DTVVENNQ 124
            + V E   
Sbjct: 1199 EAVRETED 1206


>gi|200390047|ref|ZP_03216658.1| putative L-shaped tail fiber protein [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199602492|gb|EDZ01038.1| putative L-shaped tail fiber protein [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 837

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 44/116 (37%), Gaps = 12/116 (10%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQN--IYQNQLSERKEGKKEFYDAVNMGYQ 69
             L+     P    +  NP     +   G  ++  I+  Q++     + +    VN    
Sbjct: 652 TMLVDGTATPYY-YTFGNPDGRRSVTEFGTVEDGWIFYGQVNRDLSKQLDVNGVVNA--S 708

Query: 70  LAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDT 118
                SDR +K N++ ++N       +  Y Y      +   GVIAQE+  + P+ 
Sbjct: 709 AFNQASDRDLKENIEVISNAIDRVRAIGGYTYTLKENGMPHAGVIAQEVRDVLPEA 764


>gi|301167377|emb|CBW26959.1| putative membrane-anchored cell surface protein [Bacteriovorax
            marinus SJ]
          Length = 1915

 Score = 41.2 bits (95), Expect = 0.046,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 48/126 (38%), Gaps = 16/126 (12%)

Query: 28   NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL-VSDRRMKCNVKPV 86
               T ++P +   +       ++        E  +        + L  SD+R K N+  V
Sbjct: 1718 TYGTDVSPTENPAMVTFETNGRVGIGTVDPSEQLEVNGNVKAASYLYTSDKRFKKNITLV 1777

Query: 87   -----------ANLYQYR---YLS-DPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
                         L+ +R   Y   +    +  G IAQE+ ++ P+ V  ++ G KSV Y
Sbjct: 1778 EAPLAKVDALRGVLFDWRNDEYNDLNLPEGRDYGFIAQEVEEVAPELVHTDDFGYKSVKY 1837

Query: 132  GRLFNI 137
              + +I
Sbjct: 1838 ANITSI 1843


>gi|71991056|ref|NP_496262.2| Prion-like-(Q/N-rich)-domain-bearing protein family member (pqn-47)
           [Caenorhabditis elegans]
 gi|50507473|emb|CAA88990.3| C. elegans protein F59B10.1, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
 gi|50507495|emb|CAA88602.3| C. elegans protein F59B10.1, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 931

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 59/159 (37%), Gaps = 29/159 (18%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPID-------YAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
           L+Q+    K+ +   NP    P D         G         +    + +         
Sbjct: 413 LIQSYASEKVIVRATNPGSFEPQDTDIGWQRNGGALYTQGAVSVGTEHQVESAKLTVAGD 472

Query: 67  GYQLAPLV--SDRRMKCNV------KPVANLYQ-----YRYLSDPKNVQ--------RIG 105
            Y    ++  SD R+K  +      + + NL +     YRY  +  ++         R G
Sbjct: 473 IYMSGRIINPSDIRLKEAITERETAEAIENLLKLRVVDYRYKPEVADIWGLDEQQRHRTG 532

Query: 106 VIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQ 144
           +IAQE+  + PD V  +     ++D GR+F    + T+Q
Sbjct: 533 LIAQELQAVLPDAV-RDIGDYLTIDEGRVFYETVMATQQ 570


>gi|307565665|ref|ZP_07628138.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
 gi|307345628|gb|EFN90992.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
          Length = 312

 Score = 40.9 bits (94), Expect = 0.053,   Method: Composition-based stats.
 Identities = 23/107 (21%), Positives = 39/107 (36%), Gaps = 36/107 (33%)

Query: 75  SDRRMKCNVKPV-------ANLYQYRYLSDPK--------------------NVQRIGVI 107
           SD R K NVK +        NL    Y                            + G +
Sbjct: 105 SDERAKTNVKTIDGGLNTILNLRPVSYTWKSGIGSATRSSHLMTVANGPSCDKNLQFGFL 164

Query: 108 AQEISKIRPDTVVENNQGIKSVDYGRLFNI---------GQIQTKQK 145
           AQE+ ++ PD V  + +G K ++Y  +  I         G+++ +Q+
Sbjct: 165 AQELEEVIPDAVKTDEEGRKLINYTAIIPILVKSIQDLQGKVEEQQR 211


>gi|330858765|ref|YP_004415140.1| putative long tail fiber protein [Shigella phage Shfl2]
 gi|327397699|gb|AEA73201.1| putative long tail fiber protein [Shigella phage Shfl2]
          Length = 1311

 Score = 40.9 bits (94), Expect = 0.054,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 39/104 (37%), Gaps = 18/104 (17%)

Query: 39   AGIAQN------IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV------ 86
             GI QN      IY N +   +    + Y   N+      + SD R+K N KP+      
Sbjct: 1171 TGIKQNGDGLLDIYANNVQVFRFQNGDLYSYKNINAPNVYIRSDIRLKSNFKPIENALDK 1230

Query: 87   -----ANLY-QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
                   +Y +  Y+         G++AQ +  + P+ V E   
Sbjct: 1231 VEKLNGVIYDKAEYIGGEAIETEAGIVAQTLQDVLPEAVRETED 1274


>gi|38640370|ref|NP_944293.1| Bcep22gp64 [Burkholderia phage Bcep22]
 gi|33860437|gb|AAQ54997.1| Bcep22gp64 [Burkholderia phage Bcep22]
          Length = 425

 Score = 40.9 bits (94), Expect = 0.054,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 52/151 (34%), Gaps = 40/151 (26%)

Query: 40  GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP------------------LVSDRRMKC 81
           G+  +    QL+ ++            G+ +                    +VSD R K 
Sbjct: 269 GLLSDYLATQLAGKQASGNYMRGVTGNGFTVGWDSGANHLNFFVDGNLVGFVVSDERAKK 328

Query: 82  NVKPVAN----------LYQYRYLSDPKNVQRI---GVIAQEISKIRPDTV----VENNQ 124
           N+ P +             ++ ++  P   ++    GVIAQ+  +I P+ +     ++  
Sbjct: 329 NITPSSTDALARVKALEFVEFDFIDSPYLPKKHVDNGVIAQQAQRINPNWIDKPPADHPD 388

Query: 125 GIKSVDYGRLF-----NIGQIQTKQKKNTAQ 150
               ++   L       I Q+ ++  +  A+
Sbjct: 389 AYLGLNLQYLLMDAMRAIQQLSSEVDELKAE 419


>gi|320174348|gb|EFW49497.1| Phage tail fiber protein [Shigella dysenteriae CDC 74-1112]
          Length = 469

 Score = 40.9 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 40/123 (32%), Gaps = 16/123 (13%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD----AVNMGYQLAP 72
            V  P  P     P         G       N  ++ +              N  +    
Sbjct: 312 GVAGPAGPAGPQGPKGDIGASGQGTELLTTANTWTQAQTFNGGINGNLTVTGNGSFNDIQ 371

Query: 73  LVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
           + SD+R K N+  +             LY+ +Y +D      +G+IAQ+  K  P+ V E
Sbjct: 372 IRSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSADGWQTS-VGLIAQDAQKALPELVTE 430

Query: 122 NNQ 124
           +  
Sbjct: 431 DAD 433


>gi|92119284|ref|YP_579013.1| complement C1q protein [Nitrobacter hamburgensis X14]
 gi|91802178|gb|ABE64553.1| Complement C1q protein [Nitrobacter hamburgensis X14]
          Length = 781

 Score = 40.9 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 14/82 (17%)

Query: 67  GYQLAPLVSDRRMKCNVKP-------VANLYQYRYLS-DPKNV----QRIGVIAQEISKI 114
           G      +SDRR K N+ P       +  L    +    P +     +++G+IAQE+  +
Sbjct: 652 GVGAYNALSDRRFKKNIHPADYGLAAIEKLRPVTFDWISPTSPQLHNRQLGLIAQEVQPL 711

Query: 115 RPDT--VVENNQGIKSVDYGRL 134
            P+   V  +     S+ Y  L
Sbjct: 712 VPEAVSVANDPSHTMSIAYSTL 733


>gi|224094045|ref|XP_002189806.1| PREDICTED: CCR4-NOT transcription complex, subunit 2 [Taeniopygia
           guttata]
          Length = 815

 Score = 40.9 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 29/100 (29%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRI------GVIAQEISKIRPD 117
           SD R K N++ V             L +Y Y  +  +V  I      G+IAQE+ ++ P+
Sbjct: 361 SDSRAKQNIREVDTNEQLRRITQMRLVEYDYKPEFASVMGIKDTHETGIIAQEVKRLLPE 420

Query: 118 TVVEN-----NQG-----IKSVDYGRLF--NIGQIQTKQK 145
            V E      N G        VD  ++F  N+G ++   K
Sbjct: 421 AVREVGDVACNDGEKIENFLMVDKDQIFMENVGAVKQLCK 460


>gi|304373813|ref|YP_003858558.1| gp36 small distal tail fiber subunit [Enterobacteria phage RB16]
 gi|299829769|gb|ADJ55562.1| gp36 small distal tail fiber subunit [Enterobacteria phage RB16]
          Length = 715

 Score = 40.9 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 38/120 (31%), Gaps = 13/120 (10%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMG-YQLAPLVSD 76
            TV            I   D A     +     +         + A   G +    + SD
Sbjct: 561 ATVWDATHVAAMDVHIPNNDGAQARVRLIHQSGAYYHFDGSGQFTASGNGNFNDVYIRSD 620

Query: 77  RRMKCNVKPV-----------ANLY-QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
            R+K N+  +             +Y +  ++      +  G+IAQ++ ++ P+ V     
Sbjct: 621 ERLKSNLSKIESALDKVDLLEGVIYDKADHVGGEPTSREAGLIAQQLREVLPEAVKTGED 680


>gi|138017|sp|P07067|VG37_BPT2 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
            AltName: Full=Receptor-recognizing protein
 gi|15196|emb|CAA28038.1| unnamed protein product [Enterobacteria phage T2]
          Length = 1341

 Score = 40.9 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 39/104 (37%), Gaps = 18/104 (17%)

Query: 39   AGIAQN------IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV------ 86
             GI QN      IY N +   +    + Y   N+      + SD R+K N KP+      
Sbjct: 1201 TGIKQNGDGLLDIYANSVQVFRFQNGDLYSYKNINAPNVYIRSDIRLKSNFKPIENALDK 1260

Query: 87   -----ANLY-QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
                   +Y +  Y+         G++AQ +  + P+ V E   
Sbjct: 1261 VEKLNGVIYDKAEYIGGEAIETEAGIVAQTLQDVLPEAVRETED 1304


>gi|255038279|ref|YP_003088900.1| hypothetical protein Dfer_4534 [Dyadobacter fermentans DSM 18053]
 gi|254951035|gb|ACT95735.1| hypothetical protein Dfer_4534 [Dyadobacter fermentans DSM 18053]
          Length = 361

 Score = 40.9 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 48/126 (38%), Gaps = 21/126 (16%)

Query: 6   QAFHEI-LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDA- 63
           Q ++ I   L       ++  +    + I   D  G +QN  +NQ+  R  G  + + + 
Sbjct: 159 QGYNVIASGLHSVALGTRVSTNSQTGSFILGDDGGGTSQNDAKNQMMMRFSGGYKLFTSS 218

Query: 64  -------VNMGYQLAPLVSDRRMKCNVKPVA-----------NLYQYRYLS-DPKNVQRI 104
                  +  G     ++SD R K N  PV            NL  + Y   DPK  +  
Sbjct: 219 LNVLGVQLGAGGNAWSVISDVRKKENFAPVNGEDFLQKISQINLTSWNYKGQDPKIFRHY 278

Query: 105 GVIAQE 110
           G IAQ+
Sbjct: 279 GPIAQD 284


>gi|157368780|ref|YP_001476769.1| hypothetical protein Spro_0533 [Serratia proteamaculans 568]
 gi|157320544|gb|ABV39641.1| hypothetical protein Spro_0533 [Serratia proteamaculans 568]
          Length = 378

 Score = 40.9 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 9/61 (14%)

Query: 68  YQLAPLVSDRRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
                  SD RMK +++ +         +  Y YL   + V   GVIAQE+  + P +V 
Sbjct: 264 NGTWNSSSDIRMKTDIEKIDGALEKLGKIGGYTYL--KQGVPEAGVIAQEVENVLPQSVT 321

Query: 121 E 121
            
Sbjct: 322 T 322


>gi|67477000|ref|XP_654021.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471036|gb|EAL48635.1| hypothetical protein EHI_064510 [Entamoeba histolytica HM-1:IMSS]
          Length = 524

 Score = 40.5 bits (93), Expect = 0.072,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 75  SDRRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           SD R K  + P+        N+    Y  D  N +  G IAQE+ +  PD V E+  G  
Sbjct: 201 SDSRTKTKIAPIRNALERLLNVTGKMYTYDVANAETYGFIAQELKEHFPDLVHEDESGYL 260

Query: 128 SVD 130
           S+D
Sbjct: 261 SID 263


>gi|67472891|ref|XP_652233.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56469055|gb|EAL46847.1| hypothetical protein EHI_149030 [Entamoeba histolytica HM-1:IMSS]
          Length = 581

 Score = 40.5 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 37/159 (23%), Positives = 65/159 (40%), Gaps = 30/159 (18%)

Query: 1   MDQKQQAF---HEILSLMQNVTVPKLPISLNNPTPIAPIDYAG------IAQNIYQNQLS 51
           +D +QQ     ++  +   N T+       N+       +         I QN  +NQL 
Sbjct: 81  LDIQQQCIHARNKFSNKQTNTTINSFNFDSNSLEQTLNNNQQEVQIWQCITQNCPENQLK 140

Query: 52  ------------ERKEGKKEFYDAVNMGYQLAPL-VSDRRMKCNVKP-------VANLYQ 91
                       +  E  K  Y A  +  +   L  SD R+K +++P       + NL  
Sbjct: 141 DVLQHDDFIRIVQINENLKRLYIAGEVLAENGFLQRSDARVKEHIEPLKGCVDKILNLTG 200

Query: 92  YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
             +    K+ +++G IAQE+ ++ P+ V E+  G+ SVD
Sbjct: 201 KSFKYIGKDEKKLGFIAQEVQEVCPELVHEDEFGL-SVD 238


>gi|91082767|ref|XP_973630.1| PREDICTED: similar to map kinase-activated protein kinase (mapkapk)
           [Tribolium castaneum]
 gi|270014946|gb|EFA11394.1| hypothetical protein TcasGA2_TC013565 [Tribolium castaneum]
          Length = 358

 Score = 40.5 bits (93), Expect = 0.079,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 53/135 (39%), Gaps = 12/135 (8%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   N+   I+P     I    Y     E +   ++  D +N    + P    +R+  +
Sbjct: 219 PPFYSNHGLAISPGMKNRIRMGQYTFPNPEWQNVSQDAKDLINGMLNVDPA---KRLTID 275

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRLF----- 135
            + ++N +  +Y + P+       + +E  ++ P+    +  +     VDY ++      
Sbjct: 276 -QVMSNRWIAQYTAVPQTPLHTHKMLKEGEEMWPEVQEEMTRSLATMRVDYDQVHIKTLE 334

Query: 136 -NIGQIQTKQKKNTA 149
            +   +  K++K +A
Sbjct: 335 NSNNPLLNKRRKRSA 349


>gi|114328216|ref|YP_745373.1| hypothetical protein GbCGDNIH1_1552 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316390|gb|ABI62450.1| hypothetical exported protein [Granulibacter bethesdensis CGDNIH1]
          Length = 548

 Score = 40.5 bits (93), Expect = 0.080,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 43/113 (38%), Gaps = 17/113 (15%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKE----FYDAVNMGYQ-LAPLVSDRRMKCNV----- 83
           AP   A    N   NQ+     G            + G        SD R+K ++     
Sbjct: 362 APGPAAAFGTNGSNNQIIAFSAGTSSGVQWIGSIGSNGSSVQYNTTSDYRLKTSITDLDQ 421

Query: 84  ----KPVANLYQ--YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
               + + N++   + ++S P  +   GVIA E+  + P+ V   + G + VD
Sbjct: 422 SAAAEKILNIHIKNFAFISHPDRIV-TGVIAHELQAVIPEAVTGEHDGTRHVD 473


>gi|255073495|ref|XP_002500422.1| predicted protein [Micromonas sp. RCC299]
 gi|226515685|gb|ACO61680.1| predicted protein [Micromonas sp. RCC299]
          Length = 495

 Score = 40.5 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 37/89 (41%), Gaps = 17/89 (19%)

Query: 63  AVNMGYQLAPLVS--DRRMKCNVKPVAN-----------LYQYRYLSDPKN----VQRIG 105
                Y    + S  D R K +V+ + +            + ++  + P        + G
Sbjct: 341 VTGSVYATGAVTSASDSRFKRDVRSIHDPLAIVRSLEPVTFTFKRDAFPTRDFPVETQAG 400

Query: 106 VIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +AQ++ ++ P  V E+++G K V Y RL
Sbjct: 401 FLAQDLERVLPHLVTEDDEGYKGVAYERL 429


>gi|323942219|gb|EGB38391.1| prophage tail fibre [Escherichia coli E482]
          Length = 1040

 Score = 40.5 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52  ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
            +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 873 AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDIRVISDATKAIRKMNGYTYTLKENGMPY 932

Query: 104 IGVIAQEISKIRPDTV 119
            GVIAQE+ +  P+ V
Sbjct: 933 AGVIAQEVMEAIPEAV 948


>gi|194889012|ref|XP_001977007.1| GG18472 [Drosophila erecta]
 gi|190648656|gb|EDV45934.1| GG18472 [Drosophila erecta]
          Length = 357

 Score = 40.1 bits (92), Expect = 0.091,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 46/127 (36%), Gaps = 10/127 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   N+   I+P     I    Y     E     K   D +     + P  S+R    +
Sbjct: 217 PPFYSNHGMAISPGMKKRIRTGQYDFPDPEWTNVSKAAKDLIKGMLNVDP--SERLRIQD 274

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE--NNQGIKSVDYGRLFNIGQI 140
           V  ++N +  +Y   P+     G + +E  +  P+   E   +     VDY ++    QI
Sbjct: 275 V--ISNKWIAQYNDVPQTPLCTGRMLKESEETWPEVQEEMMRSLATMRVDYDQM----QI 328

Query: 141 QTKQKKN 147
           +   K N
Sbjct: 329 KALDKSN 335


>gi|82543711|ref|YP_407658.1| tail fiber protein [Shigella boydii Sb227]
 gi|81245122|gb|ABB65830.1| putative tail fiber protein [Shigella boydii Sb227]
          Length = 195

 Score = 40.1 bits (92), Expect = 0.094,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 39/123 (31%), Gaps = 16/123 (13%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD----AVNMGYQLAP 72
            V  P  P     P         G       N  ++ +              N  +    
Sbjct: 38  GVAGPAGPAGPQGPKGDTGAPGQGTELLTTANTWTQAQTFNGGINGNLTVTGNGSFNDIQ 97

Query: 73  LVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
           + SD+R K N+  +             LY+ +Y +D      +G+IAQ+  K  P  V E
Sbjct: 98  IRSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSADGWQTS-VGLIAQDAQKALPKLVTE 156

Query: 122 NNQ 124
           +  
Sbjct: 157 DAD 159


>gi|311993249|ref|YP_004010115.1| gp37 long tail fiber, distal subunit [Enterobacteria phage CC31]
 gi|284178087|gb|ADB81753.1| gp37 long tail fiber, distal subunit [Enterobacteria phage CC31]
          Length = 870

 Score = 40.1 bits (92), Expect = 0.095,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 9/68 (13%)

Query: 73  LVSDRRMKCNVKPV----ANLYQY---RY-LSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
           L SD  +K +++ +    +NL++    RY + D  N   IGVIAQE+ ++ P+ V EN  
Sbjct: 769 LTSDISLKKDIRSIEDSRSNLHKVEIKRYAMKDGSNDNAIGVIAQEVQEVYPELVNENKD 828

Query: 125 -GIKSVDY 131
            G  SV+Y
Sbjct: 829 TGKLSVNY 836


>gi|319407668|emb|CBI81316.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 371

 Score = 40.1 bits (92), Expect = 0.097,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 54/138 (39%), Gaps = 21/138 (15%)

Query: 2   DQKQQAFHEILSLMQ-NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +Q  QA++++  L+Q   T      +    +   P        +I ++ L + +      
Sbjct: 219 EQDNQAWNQLERLLQVGTTAAGNYGTKTGESTTMP--------SITKDPLQDAQRVLGLL 270

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVA---NLYQYRYLSDPKNVQRIGVIAQEISKIRPD 117
              +         +SD  +K N+  V        Y +     + +  GV+AQ++ ++ PD
Sbjct: 271 KGIIG--------LSDVNVKENIVLVGEKNGYPLYEFNYKGSSQRYRGVLAQDLVRLNPD 322

Query: 118 TVVEN-NQGIKSVDYGRL 134
            V  N    +  V+Y +L
Sbjct: 323 AVYMNIKTHLLHVNYNKL 340


>gi|304373814|ref|YP_003858559.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB16]
 gi|299829770|gb|ADJ55563.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB16]
          Length = 819

 Score = 40.1 bits (92), Expect = 0.097,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 13/80 (16%)

Query: 58  KEFYDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRY------LSDPKNVQRI 104
              Y +VN  +    + SD R+K N+         V  L  Y Y        +    +  
Sbjct: 705 GGIYASVNGDFNDVYIRSDIRLKSNLVELKDALSKVEQLKGYIYDKKLNVEDEEPQHREA 764

Query: 105 GVIAQEISKIRPDTVVENNQ 124
           G+IAQ++ K+ P+ V EN  
Sbjct: 765 GIIAQDLQKVLPEAVKENED 784


>gi|83595261|gb|ABC25082.1| MAP kinase activated protein-kinase-2 [Glossina morsitans
           morsitans]
 gi|289740361|gb|ADD18928.1| MAP kinase-activated protein kinase 2 [Glossina morsitans
           morsitans]
          Length = 353

 Score = 40.1 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 42/127 (33%), Gaps = 10/127 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   NN   I+P     I    Y     E +   +     +     + P  S R    +
Sbjct: 216 PPFYSNNGLAISPGMKKRIRTGQYDFPNPEWQNVSQAAKSLIKGMLNVDP--SKRLTIED 273

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRLFNIGQI 140
           V    N +  +Y   P+     G + +E  +  P+    +  +     VDY ++     I
Sbjct: 274 VMR--NKWIAQYTEVPQTPLCTGRMLKEGEETWPEVQEEMTRSLATMRVDYDQM----HI 327

Query: 141 QTKQKKN 147
           +   K N
Sbjct: 328 KALDKSN 334


>gi|307138020|ref|ZP_07497376.1| hypothetical protein EcolH7_07791 [Escherichia coli H736]
          Length = 876

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52  ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
            +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 709 AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPY 768

Query: 104 IGVIAQEISKIRPDTV 119
            GVIAQE+ +  P+ V
Sbjct: 769 AGVIAQEVMEAIPEAV 784


>gi|187731452|ref|YP_001879749.1| side tail fiber protein [Shigella boydii CDC 3083-94]
 gi|187428444|gb|ACD07718.1| side tail fiber protein [Shigella boydii CDC 3083-94]
          Length = 411

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 35/93 (37%), Gaps = 16/93 (17%)

Query: 47  QNQLSERKEGKKEFYD----AVNMGYQLAPLVSDRRMKCNVKPV-----------ANLYQ 91
            N  ++ +              N  +    + SD+R K N+  +             LY+
Sbjct: 284 ANTWTQAQTFNGGINGNLTVTGNGSFNDIQIRSDKRNKRNLVKLDNALDRLEALTGYLYE 343

Query: 92  YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
            +Y +D      +G+IAQ+  K  P+ V E+  
Sbjct: 344 IQYSADGWQTS-VGLIAQDAQKALPELVTEDAD 375


>gi|291335334|gb|ADD94950.1| hypothetical protein [uncultured phage MedDCM-OCT-S01-C58]
          Length = 318

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 14/101 (13%)

Query: 49  QLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK-------PVANLYQYRYLSDPKNV 101
           Q                    L    SDRR+K N+         +  +  +R+     + 
Sbjct: 191 QFHSNGSSAGRIGIISASDVSLIDA-SDRRLKDNITDMPEAKSRINQIQMHRFRMISADS 249

Query: 102 QRIGVIAQEISKIRPDTVV---ENNQGIKSVDYGRLFNIGQ 139
              G IAQE+ ++ P  V+    +     +V+Y     +G+
Sbjct: 250 YEEGFIAQELKEVVPSAVMGSETDVDDEGNVEY---MGVGK 287


>gi|331641942|ref|ZP_08343077.1| L-shaped tail fiber protein (Protein ltf) [Escherichia coli H736]
 gi|331038740|gb|EGI10960.1| L-shaped tail fiber protein (Protein ltf) [Escherichia coli H736]
          Length = 1114

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52   ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
             +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 947  AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPY 1006

Query: 104  IGVIAQEISKIRPDTV 119
             GVIAQE+ +  P+ V
Sbjct: 1007 AGVIAQEVMEAIPEAV 1022


>gi|238821363|ref|YP_002925179.1| hypothetical protein PH10_gp46 [Streptococcus phage PH10]
 gi|238804945|emb|CAY56539.1| hypothetical protein [Streptococcus phage PH10]
          Length = 1137

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 19/96 (19%)

Query: 61   YDAVNMGYQLAPLV----SDRRMKCNV-----KPVANLYQY---RYLSDPKNVQ------ 102
            Y   +  Y L  ++    SDRR+K N+     K +  ++Q+    Y    +  +      
Sbjct: 1015 YSYNSTAYSLWSVINKHFSDRRLKDNIVDCKHKALDYIHQFQFKEYDWKKQEDRPQQAHT 1074

Query: 103  RIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIG 138
            +IG+IAQE+ ++ P  V +N   +  +D  RL NI 
Sbjct: 1075 KIGLIAQEVQEVDPTLVYKNGDTLN-LDNLRLTNIA 1109


>gi|291334968|gb|ADD94601.1| hypothetical protein [uncultured phage MedDCM-OCT-S08-C233]
          Length = 558

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 38/125 (30%), Gaps = 13/125 (10%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
            SL     V   P S      I     +G     Y       +               + 
Sbjct: 393 TSLTNATQVVFHPGSSEYGIRINSTGTSG---TQYHLSFDRGQTQAGYITSNSATTIAVN 449

Query: 72  PLVSDRRMKCNVKPVAN---------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
              SD R+K N++   +         + Q+ +  +    +  G +AQE+  I P+ V   
Sbjct: 450 N-SSDERLKENIENSGSALQDIKDLKVRQFDWKDNIDTHRDFGFVAQELHSIIPEAVSVG 508

Query: 123 NQGIK 127
           +  + 
Sbjct: 509 SDELD 513


>gi|156540485|ref|XP_001601081.1| PREDICTED: similar to CG3328-PA [Nasonia vitripennis]
          Length = 728

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 37/97 (38%), Gaps = 31/97 (31%)

Query: 75  SDRRMKCNVKP---------VANLYQYRYLSDPKNVQRIG----------VIAQEISKIR 115
           SD R K NV           V  L   RY   P+  Q +G          VIAQE+ +I 
Sbjct: 90  SDARAKQNVHELDTREQLKNVQQLRVVRYRYAPEFSQHLGLGIGTHEDTGVIAQEVKQIL 149

Query: 116 PDTVV----------ENNQGIKSVDYGRLF--NIGQI 140
           P+ V+          +       V+  R+F  NIG +
Sbjct: 150 PEAVLPAGDIVLPNGQRIDNFLVVNKERIFMENIGAV 186


>gi|50846098|gb|AAT85007.1| klebicin C phage associated protein [Klebsiella oxytoca]
          Length = 203

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 53  RKEGKKEFYDAVNMGYQL----APLVSDRRMKCNVKPVANLYQ-------YRYLSDPKNV 101
              G + +++  N G+          SD RMK  V+ + N  +       Y YL   + V
Sbjct: 70  ANGGAQGWFEFRNDGHAYTNGAWNSSSDARMKTQVEKIDNALEKLDCISGYTYL--KQGV 127

Query: 102 QRIGVIAQEISKIRPDTVVE 121
              GVIAQE+ ++ P  V +
Sbjct: 128 TEAGVIAQELEEVLPQAVSK 147


>gi|300907921|ref|ZP_07125524.1| hypothetical protein HMPREF9536_05826 [Escherichia coli MS 84-1]
 gi|300400383|gb|EFJ83921.1| hypothetical protein HMPREF9536_05826 [Escherichia coli MS 84-1]
          Length = 480

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52  ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
            +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 368 AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPY 427

Query: 104 IGVIAQEISKIRPDTV 119
            GVIAQE+ +  P+ V
Sbjct: 428 AGVIAQEVMEAIPEAV 443


>gi|269838889|ref|YP_001950049.2| hypothetical protein RSL1_gp174 [Ralstonia phage RSL1]
 gi|239793685|dbj|BAG41619.2| hypothetical protein [Ralstonia phage RSL1]
          Length = 1224

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 43/152 (28%), Gaps = 30/152 (19%)

Query: 11   ILSLMQNVTVPKLPISLNNPTPI----APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
            + + +         I++   + I    A      +    Y   +          +   N 
Sbjct: 1034 VSNTLSGTATINGTINVGTDSAISMNGASNSILQLKTTSYNRLMYLENGAGNIIFAVSNG 1093

Query: 67   GYQLAPLV-----------------SDRRMKCNVKP-------VANLYQYRYLSDPKNVQ 102
             +     +                 SDR  K +++P       V  +    +       +
Sbjct: 1094 SFGATSTLMTISGTGMVSATDFTATSDRNAKTDIQPLVGARALVLGMQGMSFTMKASGKK 1153

Query: 103  RIGVIAQEIS--KIRPDTVVENNQGIKSVDYG 132
             +G IAQ+    +   D V  N  G  S+ YG
Sbjct: 1154 SVGFIAQDFQPHQYLKDLVHTNEDGTLSLSYG 1185


>gi|161622645|ref|YP_001595372.1| gp37 long tail fiber distal subunit [Enterobacteria phage JS98]
 gi|52139851|gb|AAU29223.1| gp37 long tail fiber distal subunit [Enterobacteria phage JS98]
          Length = 1080

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 16/111 (14%)

Query: 39   AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQ 91
            AG+AQ  +   L          Y   N+      + SD R K  +K + N       L  
Sbjct: 944  AGLAQTFFNVALH----CNAGMYVRDNIDVNDVYIRSDIRCKSEIKLIENAQEKSKLLGG 999

Query: 92   YRYLSDPKNVQRI----GVIAQEISKIRPDTVVENNQ-GIKSVDYGRLFNI 137
            Y YL        +    G+IAQE+ ++ P+ V E+ + G+  ++Y  +  +
Sbjct: 1000 YTYLLKNSVTDEVKPSAGLIAQEVQEVLPELVTEDKETGLLRLNYNGIIGL 1050


>gi|195162519|ref|XP_002022102.1| GL14163 [Drosophila persimilis]
 gi|198467613|ref|XP_001354449.2| GA15916 [Drosophila pseudoobscura pseudoobscura]
 gi|194104000|gb|EDW26043.1| GL14163 [Drosophila persimilis]
 gi|198149327|gb|EAL31502.2| GA15916 [Drosophila pseudoobscura pseudoobscura]
          Length = 358

 Score = 39.3 bits (90), Expect = 0.15,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 44/127 (34%), Gaps = 10/127 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   NN   I+P     I    Y     E     +   D +     + P  S R    +
Sbjct: 217 PPFYSNNGLAISPGMKKRIRTGQYDFPDPEWTNVSQSAKDLIKGMLNVDP--SKRLRIQD 274

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRLFNIGQI 140
           V    N +  +Y + P+     G + +E  +  P+    +  +     VDY ++    QI
Sbjct: 275 VIR--NKWIAQYNAVPQTPLCTGRMLKEGEETWPEVQEEMTRSLATMRVDYDQM----QI 328

Query: 141 QTKQKKN 147
           +   K N
Sbjct: 329 KALDKSN 335


>gi|319404705|emb|CBI78307.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 371

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 52/138 (37%), Gaps = 21/138 (15%)

Query: 2   DQKQQAFHEILSLMQ-NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +Q  QA++++  L+Q          +    +   P         I ++ L + +      
Sbjct: 219 EQDNQAWNQLERLLQIGTKAAGNYGTKTGESTTMPA--------ITKDPLRDAQRVLGLL 270

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVA---NLYQYRYLSDPKNVQRIGVIAQEISKIRPD 117
              +         +SD  +K N+  V        Y +     + +  GV+AQ++ ++ PD
Sbjct: 271 KGIIG--------LSDVNVKENIVLVGEKNGYPLYEFNYKGNSQRYRGVLAQDLVRLNPD 322

Query: 118 TVVEN-NQGIKSVDYGRL 134
            V  N    +  V+Y +L
Sbjct: 323 AVYMNIKTHLLHVNYNKL 340


>gi|118082416|ref|XP_425440.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 468

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 29/100 (29%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRI------GVIAQEISKIRPD 117
           SD R K N++ V             L +Y Y  +  +V  I      G+IAQE+ ++ P 
Sbjct: 280 SDSRAKENIREVDTNEQLRRITQMRLVEYDYKPEFASVMGIENTHETGIIAQEVKELLPQ 339

Query: 118 TVVEN-----NQG-----IKSVDYGRLF--NIGQIQTKQK 145
            V E      N G        VD  ++F  N+G ++   K
Sbjct: 340 AVKEAGDVAFNDGEKIENFLMVDKDQIFMENVGAVKQLCK 379


>gi|157161023|ref|YP_001458341.1| L-shaped tail fiber protein [Escherichia coli HS]
 gi|157066703|gb|ABV05958.1| L-shaped tail fiber protein [Escherichia coli HS]
          Length = 1258

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52   ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
             +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 1091 AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPY 1150

Query: 104  IGVIAQEISKIRPDTV 119
             GVIAQE+ +  P+ V
Sbjct: 1151 AGVIAQEVMEAIPEAV 1166


>gi|315253976|gb|EFU33944.1| conserved hypothetical protein [Escherichia coli MS 85-1]
          Length = 849

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52  ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
            +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 682 AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPY 741

Query: 104 IGVIAQEISKIRPDTV 119
            GVIAQE+ +  P+ V
Sbjct: 742 AGVIAQEVMEAIPEAV 757


>gi|301307488|ref|ZP_07213475.1| hypothetical protein HMPREF9347_06041 [Escherichia coli MS 124-1]
 gi|300837351|gb|EFK65111.1| hypothetical protein HMPREF9347_06041 [Escherichia coli MS 124-1]
          Length = 854

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52  ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
            +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 687 AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPY 746

Query: 104 IGVIAQEISKIRPDTV 119
            GVIAQE+ +  P+ V
Sbjct: 747 AGVIAQEVMEAIPEAV 762


>gi|332343034|gb|AEE56368.1| L-shaped tail fiber protein [Escherichia coli UMNK88]
          Length = 841

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 74  VSDRRMKCNVKPVANLYQ-------YRYLSDPKNVQRIGVIAQEISKIRPDTV 119
           +SDR +K N++ + +  +       Y Y      +   GVIAQE+ +  P+ V
Sbjct: 704 LSDRDLKDNIQVIGDATEAIRKMNGYTYTLKENGLPYAGVIAQEVMEALPEAV 756


>gi|298374027|ref|ZP_06983985.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
 gi|298268395|gb|EFI10050.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
          Length = 404

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 93  RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           R  +   + +RIG +AQ+I K+ P+ V  +  G+ S+DY
Sbjct: 232 RREAAEASRKRIGFLAQDIQKVLPELVQTDENGMMSIDY 270


>gi|167393690|ref|XP_001740677.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165895125|gb|EDR22899.1| hypothetical protein EDI_021390 [Entamoeba dispar SAW760]
          Length = 630

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 8/63 (12%)

Query: 75  SDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           SD R+K +++P       + NL    +  + K+ + +G IAQE+ ++ P+ V E+  G+ 
Sbjct: 224 SDARVKEHIEPLKGCLDKILNLTGKSFNYNGKDEKNLGFIAQEVQEVCPELVHEDEFGL- 282

Query: 128 SVD 130
           SVD
Sbjct: 283 SVD 285


>gi|326680883|ref|XP_002667695.2| PREDICTED: myelin gene regulatory factor-like, partial [Danio
           rerio]
          Length = 833

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 39/100 (39%), Gaps = 29/100 (29%)

Query: 75  SDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRI------GVIAQEISKIRPD 117
           SDRR K N++ V             + +Y Y  +  +   I      G+IAQE+ ++ P 
Sbjct: 493 SDRRAKQNIQEVDSTEQLKRIAQMRIVEYDYRPEFASRMGIDQCHETGIIAQEVRELLPS 552

Query: 118 TVVENN----------QGIKSVDYGRLF--NIGQIQTKQK 145
            V E                 VD  ++F  N+G ++   K
Sbjct: 553 AVREMGDITCINGETIDQFLMVDKEQIFMENVGAVKQLCK 592


>gi|218553352|ref|YP_002386265.1| hypothetical protein ECIAI1_0803 [Escherichia coli IAI1]
 gi|218360120|emb|CAQ97668.1| hypothetical protein ECIAI1_0803 [Escherichia coli IAI1]
          Length = 1253

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 29/76 (38%), Gaps = 8/76 (10%)

Query: 52   ERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR 103
             +K    + +D             SDR +K ++       K +  +  Y Y      +  
Sbjct: 1086 AQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPY 1145

Query: 104  IGVIAQEISKIRPDTV 119
             GVIAQE+ +  P+ V
Sbjct: 1146 AGVIAQEVMEAIPEAV 1161


>gi|167378652|ref|XP_001733268.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165903382|gb|EDR28952.1| hypothetical protein EDI_040590 [Entamoeba dispar SAW760]
          Length = 552

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 9/90 (10%)

Query: 49  QLSERKEGKKEFYDAVNMGYQLAPL-VSDRRMKCNVKP-------VANLYQYRYLSDPKN 100
           ++ +  E  K  Y A  +  +   L  SD R+K +++P       + NL    +    K+
Sbjct: 150 RIVQINENLKRLYIAGEVLAENGFLQRSDARVKEHIEPLKGCVDKILNLTGKSFKYIGKD 209

Query: 101 VQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
            +++G IAQE+ ++ P+ V E+  G+ SVD
Sbjct: 210 DKKLGFIAQEVQEVCPELVHEDEFGL-SVD 238


>gi|150009626|ref|YP_001304369.1| hypothetical protein BDI_3040 [Parabacteroides distasonis ATCC
           8503]
 gi|298374024|ref|ZP_06983982.1| YapH protein [Bacteroides sp. 3_1_19]
 gi|301307620|ref|ZP_07213577.1| putative YapH protein [Bacteroides sp. 20_3]
 gi|149938050|gb|ABR44747.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
 gi|298268392|gb|EFI10047.1| YapH protein [Bacteroides sp. 3_1_19]
 gi|300834294|gb|EFK64907.1| putative YapH protein [Bacteroides sp. 20_3]
          Length = 292

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 47/128 (36%), Gaps = 25/128 (19%)

Query: 35  PIDYAGIAQNIYQNQLSERKEGKKE---FYDAVNMGYQLAPLV-----SDRRMKCNVKP- 85
             DY G    +     + R  G      FYD+ +  Y    +      SD R+K N+ P 
Sbjct: 37  GSDYPGTFLKLKVAVANPRISGTGGKVVFYDSESSQYNYIEVKGVYQSSDARLKTNITPL 96

Query: 86  ------VANLYQYRYLS----------DPKNVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
                 +  L    Y            +    +  G +AQE++++ P+ V  ++ G   V
Sbjct: 97  NSGLGTILGLKPVSYNWKSETSQLRSAEAVPSKAFGFLAQEVAEVMPEIVTLSSTGDSLV 156

Query: 130 DYGRLFNI 137
           DY  +  +
Sbjct: 157 DYTAVIPV 164


>gi|301307622|ref|ZP_07213579.1| conserved hypothetical protein [Bacteroides sp. 20_3]
 gi|300834296|gb|EFK64909.1| conserved hypothetical protein [Bacteroides sp. 20_3]
          Length = 393

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 93  RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           R  +   + +RIG +AQ+I K+ P+ V  +  G+ S+DY
Sbjct: 221 RREAAEASRKRIGFLAQDIQKVLPELVQTDENGMMSIDY 259


>gi|167394032|ref|XP_001740814.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165894905|gb|EDR22737.1| hypothetical protein EDI_336360 [Entamoeba dispar SAW760]
          Length = 524

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 75  SDRRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           SD R K  V P+        N+    Y  D  + +  G IAQE+ +  PD V E+  G  
Sbjct: 201 SDSRTKTKVAPIRNALERLLNVTGKMYTYDVADAETYGFIAQELKEQFPDLVHEDESGYL 260

Query: 128 SVD 130
           S+D
Sbjct: 261 SID 263


>gi|163789031|ref|ZP_02183475.1| hypothetical protein FBALC1_09497 [Flavobacteriales bacterium
           ALC-1]
 gi|159875695|gb|EDP69755.1| hypothetical protein FBALC1_09497 [Flavobacteriales bacterium
           ALC-1]
          Length = 636

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 38/96 (39%), Gaps = 20/96 (20%)

Query: 38  YAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK-------PVANLY 90
            AG+A N+Y  Q               N         SDRR+K ++K        V  L 
Sbjct: 494 NAGLASNLYLQQ-------NGGDVYVGNAIVH----SSDRRLKRDIKDISYGLDEVLKLR 542

Query: 91  QYRYLSDPK--NVQRIGVIAQEISKIRPDTVVENNQ 124
              Y    K  N + +G+IAQE++ I  + V  N +
Sbjct: 543 PTEYFWKGKTQNHKSLGLIAQEVNDIIKNVVTYNEE 578


>gi|150009628|ref|YP_001304371.1| hypothetical protein BDI_3042 [Parabacteroides distasonis ATCC
           8503]
 gi|149938052|gb|ABR44749.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 393

 Score = 38.9 bits (89), Expect = 0.20,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 93  RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           R  +   + +RIG +AQ+I K+ P+ V  +  G+ S+DY
Sbjct: 221 RREAAEASRKRIGFLAQDIQKVLPELVQTDENGMMSIDY 259


>gi|47224519|emb|CAG08769.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1166

 Score = 38.9 bits (89), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 17/67 (25%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPK------NVQRIGVIAQEISKIRPD 117
           SD R K NV+ V             L  Y+Y  +        N    GVIAQE+ +I P+
Sbjct: 661 SDIRAKENVQEVNTTDNLKRISQMRLVHYQYKPEFAATVGIENTAETGVIAQEVQQILPE 720

Query: 118 TVVENNQ 124
            V E   
Sbjct: 721 AVKEGGD 727


>gi|224002787|ref|XP_002291065.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220972841|gb|EED91172.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 2011

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 102  QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +++G IAQ++ K+ P+ V  +    K + Y RL
Sbjct: 1954 RQLGFIAQDVEKVFPELVYNDASDFKGLQYARL 1986


>gi|146311867|ref|YP_001176941.1| hypothetical protein Ent638_2216 [Enterobacter sp. 638]
 gi|145318743|gb|ABP60890.1| hypothetical protein Ent638_2216 [Enterobacter sp. 638]
          Length = 423

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 34/84 (40%), Gaps = 7/84 (8%)

Query: 61  YDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISK 113
           ++A           SD+R+K ++         +  L  Y +      V   G IAQE+ +
Sbjct: 302 FNANGQATGTWVNNSDQRIKTDIVIIPSPLAAMKKLRGYSWRRLDSGVTGFGFIAQEVQE 361

Query: 114 IRPDTVVENNQGIKSVDYGRLFNI 137
           + PD V    Q +   D  ++ N+
Sbjct: 362 VFPDAVNNFGQVMTMEDGSKVENV 385


>gi|326431896|gb|EGD77466.1| hypothetical protein PTSG_08561 [Salpingoeca sp. ATCC 50818]
          Length = 1363

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 51/133 (38%), Gaps = 27/133 (20%)

Query: 14  LMQNVTVPKLPISLNNP-TPIAPIDY---AGIAQNI--YQNQLSERKEGKKEFYDAVNMG 67
           ++Q     ++ +  +NP    + +D     G AQ+   +  Q+    +  +E        
Sbjct: 756 VVQGAQCQRIIVRASNPGQYSSEVDTQWSRGKAQSAVVHHGQVGINVDDPQEALSVAGNI 815

Query: 68  YQLAPLV--SDRRMKCNVKPV-----------ANLYQYRYLSD--------PKNVQRIGV 106
                L+  SD+R+K N+                LY+Y    +          +   +GV
Sbjct: 816 RVTGHLLQTSDKRVKENIHAASTKRHLDNVNRMTLYEYDLKEEWARKAGRSSDDRHEMGV 875

Query: 107 IAQEISKIRPDTV 119
           +AQE+ ++ PD V
Sbjct: 876 VAQELQQVLPDAV 888


>gi|255013091|ref|ZP_05285217.1| hypothetical protein B2_04243 [Bacteroides sp. 2_1_7]
          Length = 345

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 93  RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           R  +   + +RIG +AQ+I K+ P+ V  +  G+ S+DY
Sbjct: 173 RREAAEASRKRIGFLAQDIQKVLPELVQTDENGMMSIDY 211


>gi|17864380|ref|NP_524769.1| MAP kinase activated protein-kinase-2, isoform B [Drosophila
           melanogaster]
 gi|24639958|ref|NP_727032.1| MAP kinase activated protein-kinase-2, isoform C [Drosophila
           melanogaster]
 gi|28571436|ref|NP_788861.1| MAP kinase activated protein-kinase-2, isoform D [Drosophila
           melanogaster]
 gi|320541755|ref|NP_001188547.1| MAP kinase activated protein-kinase-2, isoform E [Drosophila
           melanogaster]
 gi|1346537|sp|P49071|MAPK2_DROME RecName: Full=MAP kinase-activated protein kinase 2;
           Short=MAPK-activated protein kinase 2; Short=MAPKAP
           kinase 2; Short=MAPKAPK-2
 gi|755491|gb|AAA86885.1| MAP kinase activated protein kinase-2 [Drosophila melanogaster]
 gi|10728485|gb|AAG22408.1| MAP kinase activated protein-kinase-2, isoform B [Drosophila
           melanogaster]
 gi|22831767|gb|AAN09152.1| MAP kinase activated protein-kinase-2, isoform C [Drosophila
           melanogaster]
 gi|28381566|gb|AAF46078.3| MAP kinase activated protein-kinase-2, isoform D [Drosophila
           melanogaster]
 gi|314122269|gb|ADR83709.1| LD26767p [Drosophila melanogaster]
 gi|318069315|gb|ADV37631.1| MAP kinase activated protein-kinase-2, isoform E [Drosophila
           melanogaster]
          Length = 359

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 46/127 (36%), Gaps = 10/127 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   N+   I+P     I    Y     E     +   D +     + P  S R    +
Sbjct: 217 PPFYSNHGLAISPGMKNRIRTGQYDFPDPEWTNVSQAAKDLIKGMLNVDP--SKRLRIQD 274

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRLFNIGQI 140
           V  ++N +  +Y + P+     G + +E  +  P+    +  +     VDY ++    QI
Sbjct: 275 V--ISNKWIAQYNAVPQTPLCTGRMLKEAEETWPEVQEEMTRSLATMRVDYDQM----QI 328

Query: 141 QTKQKKN 147
           +   K N
Sbjct: 329 KALDKSN 335


>gi|67475526|ref|XP_653457.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56470408|gb|EAL48071.1| hypothetical protein EHI_072090 [Entamoeba histolytica HM-1:IMSS]
          Length = 640

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 36/85 (42%), Gaps = 7/85 (8%)

Query: 73  LVSDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
             SD+R K ++         +  L    +       ++ G IAQE+ ++ PD V E+ QG
Sbjct: 185 TRSDQRTKTDIANLNNSLDLIMQLRGVTFKYKGTEQRKYGFIAQELKQVLPDLVREDTQG 244

Query: 126 IKSVDYGRLFNIGQIQTKQKKNTAQ 150
           +     G L  + +   +  +N  +
Sbjct: 245 LYIDTQGILPILVESLKQLNQNVEE 269


>gi|323934266|gb|EGB30690.1| phage tail fiber protein [Escherichia coli E1520]
          Length = 1080

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 44/128 (34%), Gaps = 35/128 (27%)

Query: 14   LMQNVTVPKLPIS-LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
             +  +   +     +NN       D      N Y         G    ++ V        
Sbjct: 935  FLGGLGNSQFGFYMINNSRTANGTD-----ANAYLQNDGTWVCGGNGSFNDV-------Y 982

Query: 73   LVSDRRMKCNVKPV-----------ANLYQY----RYLSDPKNVQRIGVIAQEISKIRPD 117
            + SDRR K N++ +             LY+     RY          G+IAQ++  ++P+
Sbjct: 983  IRSDRRSKRNIRKIERALDKLDRIEGVLYEIQVCDRYEQSG------GLIAQDVQNVQPE 1036

Query: 118  TV-VENNQ 124
             V V++N 
Sbjct: 1037 LVTVDHND 1044


>gi|320186441|gb|EFW61170.1| Phage tail fiber protein [Shigella flexneri CDC 796-83]
          Length = 109

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 12/73 (16%)

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEI 111
             N  +    + SD+R K N+  +             LY+ +Y +D      +G+IAQ+ 
Sbjct: 2   TGNGSFNDIQIRSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSADGWQTS-VGLIAQDA 60

Query: 112 SKIRPDTVVENNQ 124
            K  P+ V E+  
Sbjct: 61  QKALPELVTEDAD 73


>gi|255038797|ref|YP_003089418.1| hypothetical protein Dfer_5053 [Dyadobacter fermentans DSM 18053]
 gi|254951553|gb|ACT96253.1| hypothetical protein Dfer_5053 [Dyadobacter fermentans DSM 18053]
          Length = 533

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 44/124 (35%), Gaps = 25/124 (20%)

Query: 13  SLMQNVTVPKLPISLNNPTPIAPIDYA----GIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           + + N         +     +   D A    GI+   Y+  L+    GK         G 
Sbjct: 246 ATISNSAAIGANAKVTASNSMVLGDNANVGIGISAPSYRLHLNLNSAGKP--------GS 297

Query: 69  QLAPLVSDRRMKCNVKPVANLYQ---------YRYLSDPK----NVQRIGVIAQEISKIR 115
            L  + SD R+K N+    +            ++Y           + +G+IAQE+ KI 
Sbjct: 298 SLWAVASDSRLKQNITEFTDGLALLKQIKPVWFQYNGKAGIETGEQKFVGIIAQEMQKIA 357

Query: 116 PDTV 119
           P TV
Sbjct: 358 PYTV 361


>gi|255013093|ref|ZP_05285219.1| hypothetical protein B2_04253 [Bacteroides sp. 2_1_7]
          Length = 260

 Score = 38.6 bits (88), Expect = 0.26,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 33/81 (40%), Gaps = 17/81 (20%)

Query: 74  VSDRRMKCNVKP-------VANLYQYRYLS----------DPKNVQRIGVIAQEISKIRP 116
            SD R+K N+ P       +  L    Y            +    +  G +AQE++++ P
Sbjct: 52  SSDARLKTNITPLNSGLGTILGLKPVSYNWKSETSQLRSAEAVPSKAFGFLAQEVAEVMP 111

Query: 117 DTVVENNQGIKSVDYGRLFNI 137
           + V  ++ G   VDY  +  +
Sbjct: 112 EIVTLSSTGDSLVDYTAVIPV 132


>gi|47210713|emb|CAF90005.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 974

 Score = 38.6 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 52/149 (34%), Gaps = 34/149 (22%)

Query: 4   KQQAFHEILSLMQNVTVPKLPIS--LNNPTPIAPID-----YAGIAQNIY--QNQLSERK 54
           K Q        +     P  P S   +NP      D       G+AQ+    Q ++    
Sbjct: 500 KGQPTD-----LSRRQKPSDPPSRQASNP-GQFETDGDALWQRGLAQDSAVCQGRVGINT 553

Query: 55  EGKKEFYDAVNMGYQLAPLV--SDRRMKCNVKPV-----------ANLYQYRYLSDPKN- 100
           +   E          +  ++  SD+R KCN++ V             + ++ Y  +  + 
Sbjct: 554 DAPDEALVVCGNAKVMGAIMQPSDQRAKCNIQEVDSEQQLKRINQMRIVEFDYKPEFASS 613

Query: 101 -----VQRIGVIAQEISKIRPDTVVENNQ 124
                  + GV+AQE+ ++ P  V +   
Sbjct: 614 LGIDHTHQTGVLAQEVKELLPSAVTQVGD 642


>gi|67476753|ref|XP_653929.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56470931|gb|EAL48542.1| hypothetical protein EHI_105190 [Entamoeba histolytica HM-1:IMSS]
          Length = 487

 Score = 38.6 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD+R K N++ + N            ++Y +D     R G IAQ++ ++ P+ V E  
Sbjct: 88  VRSDKRKKHNIQKIKNALNKIVNIFCCTFKYNNDE--TIRSGFIAQQLQQVVPELVHEEI 145

Query: 124 QGIKSVD 130
            G  S+D
Sbjct: 146 DGTLSID 152


>gi|195448945|ref|XP_002071881.1| GK10232 [Drosophila willistoni]
 gi|194167966|gb|EDW82867.1| GK10232 [Drosophila willistoni]
          Length = 364

 Score = 38.6 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 44/127 (34%), Gaps = 10/127 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   N+   I+P     I    Y     E     +   D +     + P  S R    +
Sbjct: 217 PPFYSNHGLAISPGMKKRIRTGQYDFPDPEWTNVSQSAKDLIKGMLNVDP--SKRLRIED 274

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRLFNIGQI 140
           V    N +  +Y + P+     G + +E  +  P+    +  +     VDY ++    QI
Sbjct: 275 VLR--NKWIAQYSAVPQTPLCTGRMLKEGEETWPEVQEEMTRSLATMRVDYDQM----QI 328

Query: 141 QTKQKKN 147
           +   K N
Sbjct: 329 KALDKSN 335


>gi|157123126|ref|XP_001660020.1| map kinase-activated protein kinase (mapkapk) [Aedes aegypti]
 gi|108874513|gb|EAT38738.1| map kinase-activated protein kinase (mapkapk) [Aedes aegypti]
          Length = 372

 Score = 38.6 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 41/114 (35%), Gaps = 6/114 (5%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P   N+   I+P     I    Y     E +   +   D +     + P   ++R+  +
Sbjct: 237 PPFYSNHGLAISPGMKTRIRTGQYDFPNPEWQNVSQAAKDLIKGMLSVEP---EKRLTID 293

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRL 134
            + + N +   Y   P+     G + +E  +  P+    +  +     VDY ++
Sbjct: 294 -QVMRNPWVRLYTEVPQTPLHTGRVLKEGEETWPEVQEEMTRSLANMRVDYDQM 346


>gi|50846093|gb|AAT85003.1| klebicin C phage associated protein [Klebsiella pneumoniae]
          Length = 380

 Score = 38.6 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 53  RKEGKKEFYDAVNMGYQL----APLVSDRRMKCNVKPVANLYQ-------YRYLSDPKNV 101
              G + +Y+  N G+          SD RMK  V+ + N  +       Y YL   + V
Sbjct: 247 ANGGAQGWYEFRNDGHAYTNGAWNSSSDARMKTQVEKIDNALEKLDCISGYTYL--KQGV 304

Query: 102 QRIGVIAQEISKIRPDTVVE 121
              GVIAQE+ ++ P  V +
Sbjct: 305 TEAGVIAQELEEVLPQAVSK 324


>gi|300920084|ref|ZP_07136541.1| hypothetical protein HMPREF9540_03761 [Escherichia coli MS 115-1]
 gi|300412903|gb|EFJ96213.1| hypothetical protein HMPREF9540_03761 [Escherichia coli MS 115-1]
          Length = 1027

 Score = 38.6 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 41/113 (36%), Gaps = 22/113 (19%)

Query: 40   GIAQNIYQNQLSERKEG---KKEFYDAVNMGYQ---LAPLVSDRRMKCNVKPVANL---- 89
            G A +IY    S  +         Y  +  G          SD+R+K N + + N     
Sbjct: 890  GAAMDIYNPGSSAPEAALHIGGADYLFLGNGTANAIQWVSTSDKRLKSNFEEIENAVDKV 949

Query: 90   -----YQYRYLSD------PKNVQRIGVIAQEISKIRPDTVVE-NNQGIKSVD 130
                 Y Y   SD         V+  G+IAQE+ ++ P+ V       I  V+
Sbjct: 950  EKLTGYVYDKKSDLVKTEYSFEVREAGIIAQELKEVLPEAVSSFGPDEILGVN 1002


>gi|85701830|ref|NP_001028505.1| hypothetical protein LOC237558 [Mus musculus]
 gi|74190381|dbj|BAE25877.1| unnamed protein product [Mus musculus]
 gi|187956311|gb|AAI50916.1| Gene model 239, (NCBI) [Mus musculus]
 gi|187957126|gb|AAI50924.1| Gene model 239, (NCBI) [Mus musculus]
          Length = 904

 Score = 38.6 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 39/100 (39%), Gaps = 29/100 (29%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQ------RIGVIAQEISKIRPD 117
           SD R+K N++ V             + QY Y  +  +        + G+IAQE+ +I P 
Sbjct: 446 SDSRVKENIQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGINTAHQTGMIAQEVQEILPR 505

Query: 118 TVVENNQ----------GIKSVDYGRLF--NIGQIQTKQK 145
            V E                 VD  ++F  N+G ++   K
Sbjct: 506 AVREVGDVTGGNGETLENFLMVDKDQIFMENVGAVKQLCK 545


>gi|74188453|dbj|BAE25858.1| unnamed protein product [Mus musculus]
          Length = 904

 Score = 38.6 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 39/100 (39%), Gaps = 29/100 (29%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQ------RIGVIAQEISKIRPD 117
           SD R+K N++ V             + QY Y  +  +        + G+IAQE+ +I P 
Sbjct: 446 SDSRVKENIQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGINTAHQTGMIAQEVQEILPR 505

Query: 118 TVVENNQ----------GIKSVDYGRLF--NIGQIQTKQK 145
            V E                 VD  ++F  N+G ++   K
Sbjct: 506 AVREVGDVTGGNGETLENFLMVDKDQIFMENVGAVKQLCK 545


>gi|328785444|ref|XP_393650.4| PREDICTED: myelin gene regulatory factor-like [Apis mellifera]
          Length = 1139

 Score = 38.2 bits (87), Expect = 0.35,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 38/97 (39%), Gaps = 31/97 (31%)

Query: 75  SDRRMKCNVKPVAN---------LYQYRYLSDPKNVQR----------IGVIAQEISKIR 115
           SD R K NV+ V           L   RY   P+  Q            GVIAQE+ +I 
Sbjct: 532 SDARAKQNVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLGIKQQEDTGVIAQEVQQIL 591

Query: 116 PDTVV----------ENNQGIKSVDYGRLF--NIGQI 140
           P+ V+          +  +    V+  R+F  N+G +
Sbjct: 592 PEAVLPAGDIVLPNGQRIENFLMVNKERIFMENVGAV 628


>gi|195048639|ref|XP_001992567.1| GH24824 [Drosophila grimshawi]
 gi|193893408|gb|EDV92274.1| GH24824 [Drosophila grimshawi]
          Length = 354

 Score = 38.2 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 41/128 (32%), Gaps = 6/128 (4%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P    N   I+P     I    Y     E     +   D +     + P  S R    +
Sbjct: 217 PPFYSINGLSISPGMKKRIRSGQYDFPDPEWTNVSQAAKDLIKGMLNVDP--SKRLCIED 274

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRLFNIGQI 140
           V    N +  +Y + P+     G + +E  +  P+    +  +     VDY ++ N    
Sbjct: 275 VLR--NKWIAQYNAVPQTPLCTGRMLKEGEETWPEVQEEMTRSLATMRVDYDQVSNAQLA 332

Query: 141 QTKQKKNT 148
              Q   T
Sbjct: 333 SDNQHSET 340


>gi|307209791|gb|EFN86596.1| Uncharacterized protein C11orf9-like protein [Harpegnathos
           saltator]
          Length = 933

 Score = 38.2 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 38/96 (39%), Gaps = 30/96 (31%)

Query: 75  SDRRMKCNVKPVAN---------LYQYRYLSDPKNVQR---------IGVIAQEISKIRP 116
           SD R K NV+ V           L   RY   P+  Q           GVIAQE+ +I P
Sbjct: 326 SDARAKQNVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLDVKQEDTGVIAQEVQQILP 385

Query: 117 DTVV----------ENNQGIKSVDYGRLF--NIGQI 140
           + V+          +  +    V+  R+F  N+G +
Sbjct: 386 EAVLPAGDIVLPNGQRIENFLVVNKERIFMENVGAV 421


>gi|194172900|ref|YP_002003543.1| putative tail fiber protein [Escherichia phage rv5]
 gi|114795938|gb|ABI79112.1| putative tail fiber protein [Escherichia phage rv5]
          Length = 1272

 Score = 38.2 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 32/89 (35%), Gaps = 25/89 (28%)

Query: 74   VSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE----- 121
             SDR +K N+       + +  +  Y Y      +   GVIAQE+ +  P+ V       
Sbjct: 1150 SSDRDLKDNIAVIPDALEAIRKMKGYTYTLKENGMPYAGVIAQEVLEALPEAVSSFVQRK 1209

Query: 122  -----NNQG--------IKSVDYGRLFNI 137
                 +  G          SVDY  +  +
Sbjct: 1210 EIPNPDQDGTPLITEERFYSVDYAAVTGL 1238


>gi|319406190|emb|CBI79827.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 371

 Score = 38.2 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 52/139 (37%), Gaps = 21/139 (15%)

Query: 1   MDQKQQAFHEILSLMQ-NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE 59
           ++Q  +A++++  L+Q          +        P         I ++ L + +     
Sbjct: 218 LEQDNKAWNQLERLLQIGTKAAGNYGTKTGEATTMPA--------ITKDPLRDAQRVLGL 269

Query: 60  FYDAVNMGYQLAPLVSDRRMKCNVKPVA---NLYQYRYLSDPKNVQRIGVIAQEISKIRP 116
               +         +SD  +K N+  V        Y +     + +  GV+AQ++ ++ P
Sbjct: 270 LKGIIG--------LSDVNVKENIVLVGEKKGYPLYEFNYKGNSQRYRGVLAQDLIRLNP 321

Query: 117 DTVVEN-NQGIKSVDYGRL 134
           D V  N    +  V+Y +L
Sbjct: 322 DAVYMNIKTHLLHVNYNKL 340


>gi|291335322|gb|ADD94939.1| hypothetical protein [uncultured phage MedDCM-OCT-S01-C29]
          Length = 354

 Score = 38.2 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 30/85 (35%), Gaps = 22/85 (25%)

Query: 72  PLVSDRRMKCN-------VKPVANLYQYRYLS--DPKNVQRIGVIAQEISKIRPDTVVEN 122
              SD R K N        + V  L+   Y     P+  + +G  A E+ +I P  V   
Sbjct: 242 GTSSDYRRKTNPSTYTGAFEKVKQLHVREYNWIEFPEAGRTVGFFAHELQEIFPQAVTGV 301

Query: 123 NQG-------------IKSVDYGRL 134
             G              + +DYG++
Sbjct: 302 KDGMKIDEFTGEEVPDYQGIDYGKI 326


>gi|167383335|ref|XP_001736494.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165901104|gb|EDR27264.1| hypothetical protein EDI_344700 [Entamoeba dispar SAW760]
          Length = 637

 Score = 38.2 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 73  LVSDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
             SD+R K ++         +  L    +       ++ G IAQE+ ++ PD V E+ +G
Sbjct: 182 TRSDQRTKTDIANLNNSLDLIMQLRGVTFKYKGTEERKYGFIAQELKQVIPDLVREDEKG 241

Query: 126 I 126
           +
Sbjct: 242 L 242


>gi|170581054|ref|XP_001895519.1| hypothetical protein [Brugia malayi]
 gi|158597502|gb|EDP35634.1| conserved hypothetical protein [Brugia malayi]
          Length = 487

 Score = 37.8 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 83  VKPVANLYQ----YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF 135
           ++ V   Y+     ++    +N  R+GVIAQE+++I PD V +N      VD  R+F
Sbjct: 20  IRVVGYSYKPEIALKWGLSEENRHRVGVIAQELAEILPDAVTDNGD-YLQVDDSRIF 75


>gi|295695937|ref|YP_003589175.1| Glu/Leu/Phe/Val dehydrogenase dimerization region [Bacillus tusciae
           DSM 2912]
 gi|295411539|gb|ADG06031.1| Glu/Leu/Phe/Val dehydrogenase dimerization region [Bacillus tusciae
           DSM 2912]
          Length = 357

 Score = 37.8 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 74  VSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG-IKSV 129
           +++ R    ++    LY   Y+++   V  +   A EI   RP+ V    +G    V
Sbjct: 264 LAEDRHGAELEARGILYVPDYVANAGGVIHV---ADEIEGYRPERVRARVEGIYDRV 317


>gi|9634043|ref|NP_052117.1| tail fiber protein [Yersinia phage phiYeO3-12]
 gi|6599034|emb|CAB63638.1| tail fiber protein [Yersinia phage phiYeO3-12]
          Length = 645

 Score = 37.8 bits (86), Expect = 0.52,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 36/96 (37%), Gaps = 24/96 (25%)

Query: 65  NMGYQLAPLVSDRRMKCNVKPVANL--------------YQYR---YLSDPKNV------ 101
                     SDRR+K ++K V +               Y+Y+   Y  +          
Sbjct: 529 GTAVGFRWFQSDRRLKEDIKVVRSADDMLNIIRSYIPVSYKYKDASYTDNRGRTNTIEGK 588

Query: 102 -QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFN 136
             R G I Q++ ++ P+ V   + G++S D  ++  
Sbjct: 589 RSRAGFITQDLIRLWPEAVDVMSDGMQSPDPNQIIG 624


>gi|149918053|ref|ZP_01906546.1| hypothetical protein PPSIR1_41674 [Plesiocystis pacifica SIR-1]
 gi|149821058|gb|EDM80464.1| hypothetical protein PPSIR1_41674 [Plesiocystis pacifica SIR-1]
          Length = 238

 Score = 37.8 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 25/68 (36%), Gaps = 13/68 (19%)

Query: 74  VSDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
           +SDR +K + + V             +  + Y  DP   + IG +AQ+          E 
Sbjct: 128 MSDRELKRDFQTVDTQAVLDALVALPVAAWTYKDDPHAARHIGPMAQDFRAAFEVGASER 187

Query: 123 NQGIKSVD 130
              I  VD
Sbjct: 188 A--IFQVD 193


>gi|307181498|gb|EFN69086.1| Uncharacterized protein C11orf9-like protein [Camponotus
           floridanus]
          Length = 1194

 Score = 37.4 bits (85), Expect = 0.59,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 38/96 (39%), Gaps = 30/96 (31%)

Query: 75  SDRRMKCNVKPVAN---------LYQYRYLSDPKNVQR---------IGVIAQEISKIRP 116
           SD R K NV+ V           L   RY   P+  Q           GVIAQE+ +I P
Sbjct: 560 SDARAKQNVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLDVKQEDTGVIAQEVQQILP 619

Query: 117 DTVV----------ENNQGIKSVDYGRLF--NIGQI 140
           + V+          +  +    V+  R+F  N+G +
Sbjct: 620 EAVLPAGDIVLPNGQRIENFLVVNKERIFMENVGAV 655


>gi|300940788|ref|ZP_07155329.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300454453|gb|EFK17946.1| conserved hypothetical protein [Escherichia coli MS 21-1]
          Length = 122

 Score = 37.4 bits (85), Expect = 0.65,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 7/57 (12%)

Query: 75  SDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
           SD R+K  V  + +       L    +         IG IAQ++ KI P  V E   
Sbjct: 17  SDGRLKDGVSRIGDPLSKMEMLKGCSWTRKDTGQWGIGFIAQDVKKIFPQAVTEGGD 73


>gi|123443813|ref|YP_001007784.1| outer membrane efflux protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122090774|emb|CAL13656.1| outer membrane efflux protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 432

 Score = 37.4 bits (85), Expect = 0.65,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 46/118 (38%), Gaps = 9/118 (7%)

Query: 35  PIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK--PVANLYQY 92
            +D A ++   Y  +LS  +       +  +   QL     D ++K  ++  PV      
Sbjct: 42  TLDQALVSAERYSAELSANQHQVNALENMASSATQL----PDPKLKFGIENLPVGGSNAR 97

Query: 93  RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           R+  +   +QRIG++   +S    D        + +           I+T+ +K TAQ
Sbjct: 98  RFTREGMTMQRIGIMQDYVSS---DKRQRKADTLSAEARKTAAGNETIRTRLQKETAQ 152


>gi|293409525|ref|ZP_06653101.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291469993|gb|EFF12477.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 160

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 26/68 (38%), Gaps = 8/68 (11%)

Query: 60  FYDAVNMGY-QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEI 111
            +D             SDR +K ++       K +  +  Y Y      +   GVIAQE+
Sbjct: 1   MFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLKENGMPYAGVIAQEV 60

Query: 112 SKIRPDTV 119
            +  P+ V
Sbjct: 61  MEAIPEAV 68


>gi|195133488|ref|XP_002011171.1| GI16155 [Drosophila mojavensis]
 gi|193907146|gb|EDW06013.1| GI16155 [Drosophila mojavensis]
          Length = 355

 Score = 37.4 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 43/127 (33%), Gaps = 10/127 (7%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
            P    N   I+P     I    Y     E     +   D +     + P  S R    +
Sbjct: 217 PPFYSINGLSISPGMKKRIRSGQYDFPDPEWTNVSQAAKDLIKGMLNVDP--SKRLRIED 274

Query: 83  VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV--VENNQGIKSVDYGRLFNIGQI 140
           V    N +  +Y + P+     G + +E  +  P+    +  +     VDY ++    QI
Sbjct: 275 VLR--NKWIAQYDAVPQTPLCTGRMLKEGEETWPEVQEEMTRSLATMRVDYDQM----QI 328

Query: 141 QTKQKKN 147
           +   K N
Sbjct: 329 KALDKSN 335


>gi|148689861|gb|EDL21808.1| mCG125060 [Mus musculus]
          Length = 353

 Score = 37.4 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 17/67 (25%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQ------RIGVIAQEISKIRPD 117
           SD R+K N++ V             + QY Y  +  +        + G+IAQE+ +I P 
Sbjct: 215 SDSRVKENIQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGINTAHQTGMIAQEVQEILPR 274

Query: 118 TVVENNQ 124
            V E   
Sbjct: 275 AVREVGD 281


>gi|138016|sp|P08232|VG37_BPOX2 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
           AltName: Full=Receptor-recognizing protein
 gi|15125|emb|CAA29157.1| unnamed protein product [Enterobacteria phage Ox2]
          Length = 251

 Score = 37.4 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 32/85 (37%), Gaps = 15/85 (17%)

Query: 58  KEFYDAVNMGYQLAPLVSDRRMKCN--------VKPVANLYQYRY------LSDPKNVQR 103
             FY   N  +    + SD R+K N        ++ V  L  Y Y             + 
Sbjct: 122 GTFYSPGNGNFSDVYIRSDGRLKINKKELENGALEKVCRLKVYTYDKVKSIKDRSVIKRE 181

Query: 104 IGVIAQEISKIRPDTVVENN-QGIK 127
           +G+IAQ++ K  P+ V +    G  
Sbjct: 182 VGIIAQDLEKELPEAVSKVEVDGSD 206


>gi|167379170|ref|XP_001735022.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165903154|gb|EDR28804.1| hypothetical protein EDI_130810 [Entamoeba dispar SAW760]
          Length = 487

 Score = 37.4 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 73  LVSDRRMKCNVKPVANLY---------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           + SD+R K N++ + N            ++Y +D     R G IAQ++ ++ P+ V E  
Sbjct: 88  VRSDQRKKHNIQKIKNALNKIINIFCCTFKYNNDE--SIRSGFIAQQLQQVVPELVHEEI 145

Query: 124 QGIKSVD 130
            G  S+D
Sbjct: 146 DGTLSID 152


>gi|195997707|ref|XP_002108722.1| hypothetical protein TRIADDRAFT_18287 [Trichoplax adhaerens]
 gi|190589498|gb|EDV29520.1| hypothetical protein TRIADDRAFT_18287 [Trichoplax adhaerens]
          Length = 341

 Score = 37.0 bits (84), Expect = 0.77,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 26/68 (38%), Gaps = 18/68 (26%)

Query: 75  SDRRMKCNVKPV-----------ANLYQYRYLSDPKNV-------QRIGVIAQEISKIRP 116
           SD R+K  V  V             L Q++Y                 GV+AQ++ ++ P
Sbjct: 215 SDERVKHEVHEVNSSEQLRNVENMKLVQFKYKEQFAVPAGLDPSLLHTGVLAQQVKEVIP 274

Query: 117 DTVVENNQ 124
           D V++   
Sbjct: 275 DAVIKTED 282


>gi|332096585|gb|EGJ01579.1| long tail fiber protein p37 [Shigella boydii 3594-74]
          Length = 111

 Score = 37.0 bits (84), Expect = 0.77,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 30/73 (41%), Gaps = 12/73 (16%)

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEI 111
             N  +    + SD+R K N+  +             LY+ +Y +D      +G+IAQ+ 
Sbjct: 4   TGNGSFNDIQIRSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSADGWQTS-VGLIAQDA 62

Query: 112 SKIRPDTVVENNQ 124
            K  P  V E+  
Sbjct: 63  QKALPKLVTEDAD 75


>gi|326633017|ref|YP_004306606.1| hypothetical protein SPC35_0123 [Enterobacteria phage SPC35]
 gi|321272211|gb|ADW80103.1| hypothetical protein SPC35_0123 [Enterobacteria phage SPC35]
          Length = 1116

 Score = 37.0 bits (84), Expect = 0.80,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 25/61 (40%), Gaps = 11/61 (18%)

Query: 74   VSDRRMKCNVKPVANLYQYR-----------YLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
             SDR +K ++     L  Y            Y  D  N  R GVIAQ++ KI P+ V   
Sbjct: 975  SSDRDIKRDINYDDGLASYENIKQFKPTTFIYKLDKYNRVRRGVIAQDLYKIDPEYVKLV 1034

Query: 123  N 123
             
Sbjct: 1035 P 1035


>gi|66391732|ref|YP_239257.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB43]
 gi|62288820|gb|AAX78803.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB43]
          Length = 812

 Score = 37.0 bits (84), Expect = 0.80,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 13/83 (15%)

Query: 55  EGKKEFYDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRY------LSDPKNV 101
           +     Y   +  +    + SD R+K N+         V  L  Y Y        D  N 
Sbjct: 695 KASGYIYSGAHGDFNDVYIRSDIRLKSNLVELKDALSKVEQLKGYIYDKKLKVEDDEPNG 754

Query: 102 QRIGVIAQEISKIRPDTVVENNQ 124
           +  G+IAQ++ K+ P+ V EN +
Sbjct: 755 REAGIIAQDLQKVLPEAVRENEE 777


>gi|30267425|gb|AAP04369.1| gp 36-37.2 [Enterobacteria phage RB43]
          Length = 812

 Score = 37.0 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 35/87 (40%), Gaps = 20/87 (22%)

Query: 58  KEFYDAVNMGYQLAP-------LVSDRRMKCNV-------KPVANLYQYRY------LSD 97
              ++A    Y  A        + SD R+K N+         V  L  Y Y        D
Sbjct: 691 GGQFNASGYIYSGAHGDFNDVYIRSDIRLKSNLVELKDALSKVEQLKGYIYDKKLKVEDD 750

Query: 98  PKNVQRIGVIAQEISKIRPDTVVENNQ 124
             N +  G+IAQ++ K+ P+ V EN +
Sbjct: 751 EPNGREAGIIAQDLQKVLPEAVRENEE 777


>gi|291228384|ref|XP_002734150.1| PREDICTED: myelin gene regulatory factor-like [Saccoglossus
           kowalevskii]
          Length = 900

 Score = 37.0 bits (84), Expect = 0.86,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 19/69 (27%)

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSD--------PKNVQRIGVIAQEISKIR 115
           SD R+K N++ V             L  Y Y+ +         +N +  GV+AQ++  + 
Sbjct: 523 SDERVKENIEDVDTKEQLRKVAKLRLVSYDYIPEYIAHSGMSEQNSKTTGVLAQDLRDVM 582

Query: 116 PDTVVENNQ 124
           PD V E+  
Sbjct: 583 PDAVKESGD 591


>gi|319899317|ref|YP_004159414.1| hypothetical protein BARCL_1172 [Bartonella clarridgeiae 73]
 gi|319403285|emb|CBI76844.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 374

 Score = 37.0 bits (84), Expect = 0.87,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 45/125 (36%), Gaps = 18/125 (14%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           ++Q  QA++++  L++  T             I             ++ L + +      
Sbjct: 218 LEQDNQAWNQLERLLKLGTKAAGNYGTKTGESITMPSIT-------KDPLHDAQRVLGLL 270

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVA---NLYQYRYLSDPKNVQRIGVIAQEISKIRPD 117
              +         +SD ++K N+  V        Y +     + +  GV+AQ++  + PD
Sbjct: 271 KGIIG--------LSDVKVKENIVLVGKKNGYPLYEFNYKGNSQRYRGVLAQDLIHLNPD 322

Query: 118 TVVEN 122
            V  N
Sbjct: 323 AVYMN 327


>gi|270265110|ref|ZP_06193373.1| hypothetical protein SOD_k01480 [Serratia odorifera 4Rx13]
 gi|270041044|gb|EFA14145.1| hypothetical protein SOD_k01480 [Serratia odorifera 4Rx13]
          Length = 377

 Score = 36.6 bits (83), Expect = 1.00,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 24/61 (39%), Gaps = 9/61 (14%)

Query: 68  YQLAPLVSDRRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
                  SD RMK  +  +         +  Y YL   + V   GVIAQE+  + P +V 
Sbjct: 264 NGGWNSSSDIRMKTEIVKIDGALDKLGKISGYTYL--KQGVPEAGVIAQEVESVLPQSVT 321

Query: 121 E 121
            
Sbjct: 322 T 322


>gi|167772080|ref|ZP_02444133.1| hypothetical protein ANACOL_03454 [Anaerotruncus colihominis DSM
          17241]
 gi|167665878|gb|EDS10008.1| hypothetical protein ANACOL_03454 [Anaerotruncus colihominis DSM
          17241]
          Length = 204

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 20/65 (30%)

Query: 23 LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
               NNP      +        Y   +++R+ G           Y  A   SD R   N
Sbjct: 32 PDNYANNPLSDLAEEKMQEINQAYDAIVAQRRAGHSAGGQTGAGAYSGASQFSDIRRMIN 91

Query: 83 VKPVA 87
          V  +A
Sbjct: 92 VGRLA 96


>gi|171058531|ref|YP_001790880.1| lytic murein transglycosylase [Leptothrix cholodnii SP-6]
 gi|170775976|gb|ACB34115.1| lytic murein transglycosylase [Leptothrix cholodnii SP-6]
          Length = 409

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/107 (17%), Positives = 35/107 (32%), Gaps = 13/107 (12%)

Query: 19  TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD-- 76
             P        PTPI   D A       Q   S      ++      +      +  D  
Sbjct: 15  QAPAESSVGTPPTPIQADDTA------LQQDFSRWILSMRDTARTAGIDEATLAVAFDGI 68

Query: 77  ----RRMKCN-VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDT 118
               R ++ +  +P      + YL    + QRI +   ++ ++RP+ 
Sbjct: 69  RYLPRVVESDRSQPEFTRTVWDYLDRAVSPQRIALGQDKLQQVRPEA 115


>gi|155370633|ref|YP_001426167.1| hypothetical protein FR483_N535L [Paramecium bursaria Chlorella virus
            FR483]
 gi|155123953|gb|ABT15820.1| hypothetical protein FR483_N535L [Paramecium bursaria Chlorella virus
            FR483]
          Length = 1293

 Score = 35.5 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 69   QLAPLVSDRRMKCNVKP---------VANLYQYRYLSD----PKNVQRIGVIAQEISKIR 115
                  SDRR+K +++          V NL    Y        ++  ++G IAQE+ ++ 
Sbjct: 1184 GSWLATSDRRLKTDIQVANISRCEEIVRNLDLKHYAWTDVVPGEDRSQLGWIAQELEEVF 1243

Query: 116  PDTV 119
            P +V
Sbjct: 1244 PKSV 1247


>gi|155122212|gb|ABT14080.1| hypothetical protein MT325_M526L [Paramecium bursaria chlorella virus
            MT325]
          Length = 1098

 Score = 35.5 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 26/64 (40%), Gaps = 13/64 (20%)

Query: 69   QLAPLVSDRRMKCNVKP---------VANLYQYRYLSDPKNV----QRIGVIAQEISKIR 115
                  SDRR+K +++          V NL    Y            ++G IAQE+ ++ 
Sbjct: 989  GSWLATSDRRLKTDIQVANISRCEEIVRNLDLKHYDWTDAVPGEDRSQLGWIAQELEEVF 1048

Query: 116  PDTV 119
            P +V
Sbjct: 1049 PKSV 1052


>gi|332667272|ref|YP_004450060.1| hypothetical protein Halhy_5362 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332336086|gb|AEE53187.1| hypothetical protein Halhy_5362 [Haliscomenobacter hydrossis DSM
           1100]
          Length = 271

 Score = 35.1 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 95  LSDPKNVQ--RIGVIAQEISKIRPDTVVENNQGIKSVDY 131
           L++    Q  ++G  AQ++ KI P  V ++ QG+ SV+Y
Sbjct: 202 LAEESKPQKDQLGFSAQDVQKILPQLVTQDEQGMLSVNY 240


>gi|108796903|ref|YP_636201.1| cytochrome f [Pseudendoclonium akinetum]
 gi|122239526|sp|Q3ZJ66|CYF_PSEAK RecName: Full=Apocytochrome f; Flags: Precursor
 gi|56159601|gb|AAV80625.1| apocytochrome f of cytochrome b6/f complex [Pseudendoclonium
           akinetum]
          Length = 329

 Score = 34.7 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 9/97 (9%)

Query: 16  QNVTVPKLPISLNNPTPIAP-IDYAGIAQNIYQNQLSERKEGKK------EFYDAVNMGY 68
            N  + + P+ L  P  + P   +  + +  Y  Q+ + +   K           +  G+
Sbjct: 66  ANCHLAQKPVELEVPQAVLPDTVFEAMVKIPYDQQIKQVQANGKKGDLNVGMVLILPEGF 125

Query: 69  QLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIG 105
           +LAP  SDR  +   K V NLY   Y S+ KN+  IG
Sbjct: 126 ELAP--SDRLPEEMKKKVGNLYYQPYSSEQKNILVIG 160


>gi|265985067|ref|ZP_06097802.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264663659|gb|EEZ33920.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 299

 Score = 34.3 bits (77), Expect = 5.2,   Method: Composition-based stats.
 Identities = 6/19 (31%), Positives = 10/19 (52%)

Query: 3   QKQQAFHEILSLMQNVTVP 21
           Q+ Q  +EI +L+    V 
Sbjct: 280 QRNQPINEISALLSGAQVT 298


>gi|310005749|gb|ADP00136.1| predicted protein [Cyanophage NATL1A-7]
          Length = 557

 Score = 33.5 bits (75), Expect = 9.4,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 27/60 (45%), Gaps = 9/60 (15%)

Query: 74  VSDRRMKCNVKPVANLYQ---------YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
           +SD ++K N+    + ++         + + +     + +GV+AQE+    P  VVE   
Sbjct: 450 ISDIKLKENIVDAGSQWEDIKAIKVRNFNFKASKSKKKLLGVVAQELETTSPGLVVETPD 509


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.303    0.130    0.330 

Lambda     K      H
   0.267   0.0400    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,327,453,503
Number of Sequences: 14124377
Number of extensions: 78989463
Number of successful extensions: 236366
Number of sequences better than 10.0: 329
Number of HSP's better than 10.0 without gapping: 134
Number of HSP's successfully gapped in prelim test: 308
Number of HSP's that attempted gapping in prelim test: 235957
Number of HSP's gapped (non-prelim): 490
length of query: 150
length of database: 4,842,793,630
effective HSP length: 113
effective length of query: 37
effective length of database: 3,246,739,029
effective search space: 120129344073
effective search space used: 120129344073
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.8 bits)
S2: 75 (33.5 bits)