BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781131|ref|YP_003065544.1| hypothetical protein
CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62]
         (150 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040808|gb|ACT57604.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 150

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 150/150 (100%), Positives = 150/150 (100%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF
Sbjct: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
           YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV
Sbjct: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120

Query: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ
Sbjct: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150


>gi|227822435|ref|YP_002826407.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234]
 gi|227341436|gb|ACP25654.1| hypothetical protein NGR_c18900 [Sinorhizobium fredii NGR234]
          Length = 453

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 47/150 (31%), Positives = 73/150 (48%), Gaps = 8/150 (5%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
             + Q  +EI +L+    V            I P+DYAG+ Q  YQNQ++     ++   
Sbjct: 304 ALRNQPINEISALLSGAQVTTPNFVPTQGQSIQPVDYAGLVQQNYQNQMAAYNARQQSGG 363

Query: 62  DAVNMGYQLA--PLVSDRRMKCNVKPVA-----NLYQYRYLSD-PKNVQRIGVIAQEISK 113
           + +     +     +SDRR K N++ V      NLY++ Y  +     + IGV+AQE+ +
Sbjct: 364 NLLGNVLGMFEKIPLSDRRAKKNIEKVGRLKAHNLYEFDYKGEQAGGPKHIGVMAQEVER 423

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQIQTK 143
            RPD V+    G++ VDYGRLF  G    K
Sbjct: 424 TRPDAVIRGPDGMRRVDYGRLFAAGHRGRK 453


>gi|327191473|gb|EGE58493.1| hypothetical protein RHECNPAF_300003 [Rhizobium etli CNPAF512]
          Length = 335

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 59/146 (40%), Gaps = 11/146 (7%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNI-------YQNQLSER 53
           + ++ Q  +EI +LM    V +        T +  +D AG+           Y  Q+++ 
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPNYVNTPTTQLPNVDQAGLINENFNQKMGLYDRQVAQS 248

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQ 109
                  +   +       + SDRR+K ++K V  L      Y +        ++G+++ 
Sbjct: 249 NAAMGGLFGLGSSLLGGWAMKSDRRLKEDIKRVGTLENGLPVYAFRYKEGGPMQLGLMSD 308

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLF 135
           ++ K  PD V E+  G   VDY R  
Sbjct: 309 DVRKTHPDAVFEHADGFDRVDYERAV 334


>gi|116253668|ref|YP_769506.1| hypothetical protein RL3928 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258316|emb|CAK09418.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 335

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 60/146 (41%), Gaps = 11/146 (7%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKE----- 55
           + ++ Q  +EI +LM    V +        T +  +D AG+    Y  Q+          
Sbjct: 189 LTERNQPLNEISALMSGSQVNQPNYVNAPTTQLPTVDQAGLINENYNQQMGAYNSQVSKS 248

Query: 56  --GKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQ 109
                  +   +       + SDRR+K ++K V  L      Y +        +IG+++ 
Sbjct: 249 NAAMGGLFGLGSSLLGGWAMGSDRRLKEDIKRVGTLDNGLPVYVFRYKKGGPTQIGLMSD 308

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLF 135
           ++ ++ P++V E+ +G   VDY +  
Sbjct: 309 DVREVHPESVFEDAEGFDRVDYEKAV 334


>gi|13470675|ref|NP_102244.1| hypothetical protein mll0449 [Mesorhizobium loti MAFF303099]
 gi|14021417|dbj|BAB48030.1| mll0449 [Mesorhizobium loti MAFF303099]
          Length = 230

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 10/146 (6%)

Query: 4   KQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK----- 58
           + Q  +EI +L+    V     +   P+ I   D AGI  N YQ ++             
Sbjct: 85  RNQPINEITALLSGSQVSNPQAAAYTPSTIPTTDNAGIIANNYQQKMDAYNAQMSQASSL 144

Query: 59  ----EFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKN-VQRIGVIAQEISK 113
                      +         D+    ++ P   L+++ Y  +P +   R+G++A E+ K
Sbjct: 145 AGGLFGLGGKLISLSDDDAKKDKERLADITPEMGLWKFHYKGEPADAPMRLGLMASEVEK 204

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQ 139
           +RPD V     G + VDYG+  ++G 
Sbjct: 205 VRPDAVSRRPDGYRQVDYGKALSLGA 230


>gi|218673260|ref|ZP_03522929.1| hypothetical protein RetlG_17541 [Rhizobium etli GR56]
          Length = 334

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 59/147 (40%), Gaps = 12/147 (8%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNI-------YQNQLSER 53
           + ++ Q  +EI +LM    V +        T +  +D AG+           Y  Q+++ 
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPNYVNTPTTQLPNVDQAGLINENFNQKMGLYDRQVAQS 248

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQ 109
                  +   +         SDRR+K ++K V  L      Y +        ++G+++ 
Sbjct: 249 NAAMGGLFGLGSSLLGGW-AKSDRRLKEDIKRVGTLENGLPVYAFRYKEGGPMQLGLMSD 307

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLFN 136
           ++ K  PD VVE+  G   VDY R   
Sbjct: 308 DVRKTHPDAVVEHADGFDRVDYERAVA 334


>gi|110632598|ref|YP_672806.1| hypothetical protein Meso_0237 [Mesorhizobium sp. BNC1]
 gi|110283582|gb|ABG61641.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 322

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/142 (29%), Positives = 67/142 (47%), Gaps = 13/142 (9%)

Query: 1   MDQKQQAFHEILSLMQNVTV--PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK 58
           + Q+ Q  +EI+ LM    V  P    +    + +A +DY G+    YQ  ++  + G  
Sbjct: 185 LAQRNQPLNEIIGLMSGTQVQNPNATFAQTPQSGVAGVDYTGLVNQKYQADVANYRAGMG 244

Query: 59  EFYDAVNMGYQLAPLVSDRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEIS 112
             +   +    L P  SD R+K +++ V        +Y +RY  DP  V  IGV+AQE+ 
Sbjct: 245 GLFGLGSALIGLLP-SSDERLKSDIRRVGTTDGGVPIYIFRYRDDPFKVWHIGVMAQEV- 302

Query: 113 KIRPDTVVENNQGIKSVDYGRL 134
              P+  V +  G   VDYGR+
Sbjct: 303 ---PEARVSDESGFFRVDYGRV 321


>gi|150397020|ref|YP_001327487.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419]
 gi|150028535|gb|ABR60652.1| hypothetical protein Smed_1817 [Sinorhizobium medicae WSM419]
          Length = 532

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 4/141 (2%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q+ Q  +EI+ LM    V           P+  +DYAG+ Q  Y N++   ++ +    
Sbjct: 389 AQRNQPINEIVGLMSGAQVDSPSFVPTQSNPMPTVDYAGLVQQDYANKMGAYQQKQSTMQ 448

Query: 62  DAVNMGYQLA---PLVSDRRMKCNVKPVANLYQYRYLSDPKN-VQRIGVIAQEISKIRPD 117
           +              +SD+R K ++K V  LY+YRY  + +N  +RIGV+AQE+ K+RPD
Sbjct: 449 NLFGGMLGFGGQLASLSDKRAKKDIKKVGGLYEYRYKGEGRNAPKRIGVMAQEVEKVRPD 508

Query: 118 TVVENNQGIKSVDYGRLFNIG 138
            V +   G++ VDYG LFN G
Sbjct: 509 AVAKGADGLRRVDYGLLFNAG 529


>gi|316933872|ref|YP_004108854.1| hypothetical protein Rpdx1_2530 [Rhodopseudomonas palustris DX-1]
 gi|315601586|gb|ADU44121.1| hypothetical protein Rpdx1_2530 [Rhodopseudomonas palustris DX-1]
          Length = 341

 Score =  100 bits (248), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 36/151 (23%), Positives = 56/151 (37%), Gaps = 20/151 (13%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKE------ 55
            ++    +EI +L+    V     S    T +A  DYAG+  N Y  Q+           
Sbjct: 189 AERNAPINEITALLSGSQVSAPNYSSTPTTGVAGTDYAGMVSNNYGQQMQAYNNKLQSNN 248

Query: 56  -GKKEFYDAVNMGYQ-------LAPLVSDRRMKCNVKPVAN----LYQYRYLSDPKNVQR 103
                 +                   +SDRR+K ++         L  Y Y       + 
Sbjct: 249 AAMGGMFGLAGTLGAAGMKYGPTWMAMSDRRLKSDIVDTGETFAGLPVYEYTIF--GRRE 306

Query: 104 IGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            GV+A E+ ++ P+ V  +  G K VDYGRL
Sbjct: 307 RGVMADEVEQVMPEAVALHPSGFKMVDYGRL 337


>gi|209548343|ref|YP_002280260.1| hypothetical protein Rleg2_0738 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534099|gb|ACI54034.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 334

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 55/146 (37%), Gaps = 10/146 (6%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSER------K 54
           + ++ Q  +EI +LM    V +        T +  +D AG+  + +  ++          
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPSYVNTPTTQLPNVDQAGLINDSFNQKMGLYDRQVSQS 248

Query: 55  EGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQE 110
                    +          SDRR+K +++ V  L      Y +        +IG+++ +
Sbjct: 249 NAAMGGLFGLGGTLLGGWAKSDRRLKEDIRRVGTLDNGLPVYAFKYKDGGPTQIGLMSDD 308

Query: 111 ISKIRPDTVVENNQGIKSVDYGRLFN 136
           + +  PD V E+  G   V Y R   
Sbjct: 309 VRRTHPDAVFEHADGFDRVFYERAVA 334


>gi|86356745|ref|YP_468637.1| hypothetical protein RHE_CH01103 [Rhizobium etli CFN 42]
 gi|86280847|gb|ABC89910.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 334

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 56/146 (38%), Gaps = 10/146 (6%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKE----- 55
           + ++ Q  +EI +LM    V +        T +  +D AG+    +  ++    +     
Sbjct: 189 LTERNQPLNEISALMSGSQVHQPNYVNTPTTQLPTVDQAGLINENFNQKMGIYNQQLAQS 248

Query: 56  -GKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQE 110
                    +          SDRR+K ++K V  L      Y +        ++G+++ +
Sbjct: 249 NAAMGGLFGLGGTLLGGWAKSDRRLKQDIKRVGTLENGLPVYAFRYKEGGPMQLGLMSDD 308

Query: 111 ISKIRPDTVVENNQGIKSVDYGRLFN 136
           + +I PD V E+  G   VD  R   
Sbjct: 309 VREIHPDAVFEHADGFDRVDNERAVA 334


>gi|315122526|ref|YP_004063015.1| hypothetical protein CKC_03890 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495928|gb|ADR52527.1| hypothetical protein CKC_03890 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 389

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 84/136 (61%), Positives = 107/136 (78%), Gaps = 1/136 (0%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +DQKQQA HEILSLMQ +   K PI+ NNP  I P+DY  I+QN YQN+  E K+ K+  
Sbjct: 244 IDQKQQALHEILSLMQTIPASKFPITQNNPIAITPVDYREISQNDYQNRFQEWKQRKQNI 303

Query: 61  YDAVNMGYQL-APLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
           YD++N+G +L   ++SDRRMK ++KPV NLYQYRY+SDPK  QRIGV+AQEI+KIRPD V
Sbjct: 304 YDSINIGNKLVGSILSDRRMKRDIKPVGNLYQYRYVSDPKRTQRIGVMAQEINKIRPDAV 363

Query: 120 VENNQGIKSVDYGRLF 135
           V+N+QG++SVDYG LF
Sbjct: 364 VKNSQGLQSVDYGLLF 379


>gi|42523143|ref|NP_968523.1| hypothetical protein Bd1641 [Bdellovibrio bacteriovorus HD100]
 gi|39575348|emb|CAE79516.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 692

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 48/151 (31%), Gaps = 15/151 (9%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             I S         + I     T      YA + +    +            +     G 
Sbjct: 501 SSISSFDTLNQFTGIVIRSPTGTGTITNKYAMLTEANAGSVGIGTLTPAYMLHVNGTAGG 560

Query: 69  QLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDPK--------NVQRIGVIAQEISK 113
                 SDRR K N+  +         L    Y             N Q++G+IAQE+  
Sbjct: 561 TSWANTSDRRFKRNIATIDSSLEKVLQLRGVTYDWRTDEFPQKNFENGQQVGLIAQEVQS 620

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQIQTKQ 144
           + PD V ++N+G  +V Y  L        K+
Sbjct: 621 VFPDVVTKDNEGFLAVQYANLVAPLIEAMKE 651


>gi|313768276|ref|YP_004061956.1| hypothetical protein MpV1_073 [Micromonas sp. RCC1109 virus MpV1]
 gi|312598972|gb|ADQ90996.1| hypothetical protein MpV1_073 [Micromonas sp. RCC1109 virus MpV1]
          Length = 256

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 46/136 (33%), Gaps = 8/136 (5%)

Query: 19  TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
           T          P        + I  +     +     G     +          + SD R
Sbjct: 119 TGGVYSQGNPVPVTQWTTLNSNIYYSSGNVGIGTDIPGYTLDVNGTVYASGDVIMFSDER 178

Query: 79  MKCNVKPVA-------NLYQYRYLSDPKNVQ-RIGVIAQEISKIRPDTVVENNQGIKSVD 130
            K N+KP+         L    +       +   G+IAQEI K+ P+ V  ++ G+K V 
Sbjct: 179 KKTNIKPITNALDKVLQLRGVTFDKIGDGTRRHAGIIAQEIEKVLPEVVYTDDDGMKGVA 238

Query: 131 YGRLFNIGQIQTKQKK 146
           YG +  +     K+ K
Sbjct: 239 YGNIIALLIEAIKELK 254


>gi|22034301|gb|AAL01543.1| GP37 [Escherichia fergusonii]
          Length = 123

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 8/83 (9%)

Query: 74  VSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI 126
            SD  +K N+       + +  L    Y         +G+IAQ++ K+ P+ V      I
Sbjct: 30  FSDENLKENIKPLDHSLEKILKLKGVSYTWKEDKTGDVGLIAQDVEKVYPELVKT-KGEI 88

Query: 127 KSVDYGRLFNIGQIQTKQKKNTA 149
           K VDY +L        ++++N  
Sbjct: 89  KQVDYQKLVAPLIEAVREQQNEI 111


>gi|42522678|ref|NP_968058.1| putative YapH protein [Bdellovibrio bacteriovorus HD100]
 gi|39573874|emb|CAE79051.1| putative YapH protein [Bdellovibrio bacteriovorus HD100]
          Length = 1492

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 54/144 (37%), Gaps = 10/144 (6%)

Query: 11   ILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQL 70
            +      + V     +    T     + A IAQ  Y       ++   +    + +   L
Sbjct: 1295 LSRADSALNVNNNHATKRGFTIHQTNNAANIAQFYYCPGGVCSQKFYLDTNGNMWIAGNL 1354

Query: 71   APLVSDRRMKCNVK-------PVANLYQYRYLSD--PKNVQRIGVIAQEISKIRPDTVVE 121
                SD R+K +++        V  L  Y Y         ++IG+IAQE+ K+ P+ V  
Sbjct: 1355 TEA-SDARLKTDIQILPDSLNKVLGLNGYSYYWKNPENKEKQIGLIAQEVEKVFPEAVRT 1413

Query: 122  NNQGIKSVDYGRLFNIGQIQTKQK 145
            +  G KSV Y +L        K+ 
Sbjct: 1414 DKDGSKSVAYQKLVAPLINSIKEL 1437


>gi|253583148|ref|ZP_04860356.1| predicted protein [Fusobacterium varium ATCC 27725]
 gi|251835040|gb|EES63593.1| predicted protein [Fusobacterium varium ATCC 27725]
          Length = 587

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 51/127 (40%), Gaps = 12/127 (9%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------V 86
               Y G+      +  S           A+     +    SD R+K N+KP       +
Sbjct: 449 GGTIYGGVDIQNAHSANSYYSRSTITSAGAITSSSNVV-AYSDIRLKENLKPLTNTLDII 507

Query: 87  ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ----GIKSVDYGRLFNIGQIQT 142
            NL  Y Y       + IGVIAQE+ ++ P+ V+E +      IK VDYG+L  +     
Sbjct: 508 DNLNVYHYNWKDTKKEDIGVIAQEVEQVFPELVIEIDDPVKGKIKGVDYGKLATVSLQAI 567

Query: 143 KQKKNTA 149
           K+ K   
Sbjct: 568 KELKQEI 574


>gi|319783503|ref|YP_004142979.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169391|gb|ADV12929.1| hypothetical protein Mesci_3812 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 330

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 57/145 (39%), Gaps = 12/145 (8%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKE---GK 57
           + Q     + + +L+    V +      N   I   D AG+    Y  QL + ++     
Sbjct: 189 LAQNSAPINNLTALLSGSQVSQPNFVNANMPTIPTTDTAGLINTNYNQQLQKWQQDASSS 248

Query: 58  KEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEI 111
            +    +          SDRR+K N++ +         Y + YL      +++GV+A E+
Sbjct: 249 SDLMGGLFGLGANLIKFSDRRLKKNIRAIGTFANGLTKYVFEYLW--GGGEQVGVMADEV 306

Query: 112 SKIRPDTVVENNQGIKSVDYGRLFN 136
              RP  V     G  +VDYGR F 
Sbjct: 307 RAYRPYAVTTV-NGFDAVDYGRAFA 330


>gi|255036291|ref|YP_003086912.1| hypothetical protein Dfer_2529 [Dyadobacter fermentans DSM 18053]
 gi|254949047|gb|ACT93747.1| hypothetical protein Dfer_2529 [Dyadobacter fermentans DSM 18053]
          Length = 456

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 53/141 (37%), Gaps = 12/141 (8%)

Query: 21  PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
                   N +      + G+A +      S  K       +   +      L SD+R+K
Sbjct: 286 NTTARVYFNNSSGVAESFVGMANDNEIGLYSGGKWLLVANKNGT-VYMDNYYLTSDKRLK 344

Query: 81  CNVK-------PVANLYQYRYLSDPKNVQRI---GVIAQEISKIRPDTVVENNQGIKSVD 130
            + K        ++ L  Y Y        +    G+IAQE+ K+ P+ V  ++ G KS++
Sbjct: 345 TDFKNLSASLAKISQLQGYSYRWLDTTRTQTLQTGLIAQEVEKLFPELVNTDDNGYKSMN 404

Query: 131 YGRLFNIGQIQTKQKK-NTAQ 150
           Y  L        K+ K  TAQ
Sbjct: 405 YNGLIPHLIEAVKELKGQTAQ 425


>gi|167379710|ref|XP_001735250.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165902849|gb|EDR28569.1| hypothetical protein EDI_338220 [Entamoeba dispar SAW760]
          Length = 679

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 10/91 (10%)

Query: 69  QLAPLVSDRRMKCNVKPVAN-LYQ--------YRYLSDPKNVQRIGVIAQEISKIRPDTV 119
               + SD R K +++ + N L          Y Y  D  N +  G IAQE+ KI P+ V
Sbjct: 231 NGFLVRSDARSKTDIEEIHNSLNGILSLVGVSYSYKKDCDNKKY-GFIAQEVQKIYPELV 289

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            E++ G  +VDY  +  +     K+  N AQ
Sbjct: 290 KEDDTGKLTVDYLGIIPLLVEALKEIHNNAQ 320


>gi|326783687|ref|YP_004324081.1| fiber [Synechococcus phage S-SSM7]
 gi|310003699|gb|ADO98094.1| fiber [Synechococcus phage S-SSM7]
          Length = 2328

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/161 (13%), Positives = 49/161 (30%), Gaps = 16/161 (9%)

Query: 5    QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
                     L    T       ++       +       N     +           +++
Sbjct: 2159 NVTSSFTGDLAGRSTASDTSKIISAGGGGYNVVLTDGLGNNKGLAIDGGITFNGGS-NSL 2217

Query: 65   NMGYQLAPLVSDRRMKCNVKPV-------ANLYQYRYLSDPKN-------VQRIGVIAQE 110
             +   +    SD R+K N++ +         L  + Y  +           +++GV AQ+
Sbjct: 2218 TVSGDITAFASDMRLKTNIEKIQGAVAKVCKLSGFTYEFNETGRDLKLPAGKQLGVSAQQ 2277

Query: 111  ISKIRPDTVVENN-QGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            + +I P+ V         +V Y +L  +     K+ K   +
Sbjct: 2278 VQEIFPEAVAVRPIDEYLTVKYEKLVPVLIEAIKELKEEIE 2318


>gi|183230818|ref|XP_654628.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169802761|gb|EAL49242.2| hypothetical protein EHI_142010 [Entamoeba histolytica HM-1:IMSS]
          Length = 679

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 10/91 (10%)

Query: 69  QLAPLVSDRRMKCNVKPVAN-LYQ--------YRYLSDPKNVQRIGVIAQEISKIRPDTV 119
               + SD R K +++ + N L          Y Y +D  N +  G +AQ++ KI PD V
Sbjct: 231 NGFLVRSDARSKTDIEEIHNSLNGILSLVGVSYSYKNDSDNKKY-GFVAQDVQKIYPDLV 289

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            E++ G  +VDY  +  +     K+  N AQ
Sbjct: 290 KEDDTGKLTVDYLGIIPLLVEALKEIHNNAQ 320


>gi|42524004|ref|NP_969384.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39576212|emb|CAE80377.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1416

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 48/146 (32%), Gaps = 8/146 (5%)

Query: 9    HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
            + + +         +  SL     +   D A +                +      N+  
Sbjct: 1214 NTVSAGNSITIGQSITNSLMGTMQVGLSDTAKMTILSTGRFGINTTAPSEALEVNGNVKA 1273

Query: 69   QLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
                  SD R+K +V  +         L    ++      + +G IAQE+  + P+ V  
Sbjct: 1274 ASYLYTSDARLKKDVVTLPMALENLLKLRGVNFVWKNNGEKTVGFIAQEVEAVYPELVRT 1333

Query: 122  NN-QGIKSVDYGRLFNIGQIQTKQKK 146
            +   G KSV YG +  I     KQ+ 
Sbjct: 1334 DKVSGFKSVQYGNIVAILVEALKQEH 1359


>gi|67477509|ref|XP_654215.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471246|gb|EAL48829.1| hypothetical protein EHI_122890 [Entamoeba histolytica HM-1:IMSS]
          Length = 612

 Score = 81.7 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 57/152 (37%), Gaps = 11/152 (7%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +EI+      T   L  S          +       + + +    K  +      +    
Sbjct: 151 NEIIKTDSETTENILNNSQEYQIVEEGNNEEYKINELLKIKGIRNKVQQLYMLGEIFSNE 210

Query: 69  QLAPLVSDRRMKCNVKPVA-------NLYQYRYLS--DPKNV-QRIGVIAQEISKIRPDT 118
               + SD R K  ++ +        +LY   +    DP++  +R G IAQE+ +I P+ 
Sbjct: 211 G-FLVRSDERNKKEIEKIDKALYGLKHLYGREFKYLRDPEDKARRYGFIAQEVKEIYPEL 269

Query: 119 VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           V  + +G  +VDY  +  I     K+ +  ++
Sbjct: 270 VQIDEEGGLTVDYLGIIPIMVEALKEIEKESE 301


>gi|255036788|ref|YP_003087409.1| hypothetical protein Dfer_3029 [Dyadobacter fermentans DSM 18053]
 gi|254949544|gb|ACT94244.1| hypothetical protein Dfer_3029 [Dyadobacter fermentans DSM 18053]
          Length = 323

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 45/156 (28%), Gaps = 18/156 (11%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           M  K QA       +                 +   D  G                    
Sbjct: 151 MRIKHQAGSTAGLFLDGSKTDDYQKGPAAFMGMVTDDQVGFFIGDA--------WRFYVH 202

Query: 61  YDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQ---RIGVIAQE 110
            +            SDRR+K ++         +  L  Y Y    +      + G +AQ+
Sbjct: 203 ANGNATLTGNLTQNSDRRLKSDLTALQGSRHKILGLSGYHYRWASEKRSRALQTGFVAQD 262

Query: 111 ISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
           +  + P+ V  + QG KSV+Y  L        K+ +
Sbjct: 263 VEAVLPELVETDAQGYKSVNYIGLIPHLVEAFKELQ 298


>gi|238801675|ref|YP_002922731.1| gp59 [Burkholderia phage BcepIL02]
 gi|237688050|gb|ACR15052.1| gp59 [Burkholderia phage BcepIL02]
          Length = 339

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 55/140 (39%), Gaps = 10/140 (7%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
           +   +  +L    N+ TP   I  +   +  + NQ    +    +    V +   +    
Sbjct: 190 LDGASERQLIGMSNDATPNVDIINSAAGKIRFINQAYNAELLTCDNNGNVWVLGNIVGF- 248

Query: 75  SDRRMKCNVKPVA-------NLYQYRYLSD--PKNVQRIGVIAQEISKIRPDTVVENNQG 125
           SDRR+K N+K +         L    +         + +G IAQ++  I P+ V  + +G
Sbjct: 249 SDRRLKSNIKRIKGAMAKVRELVGVTFTRRRSKDKSRHMGFIAQDVEPIVPEVVRTDEKG 308

Query: 126 IKSVDYGRLFNIGQIQTKQK 145
           +KS+ Y  L  +     K+ 
Sbjct: 309 MKSIAYPNLTALLAEALKEL 328


>gi|312200835|ref|YP_004020896.1| hypothetical protein FraEuI1c_7061 [Frankia sp. EuI1c]
 gi|311232171|gb|ADP85026.1| hypothetical protein FraEuI1c_7061 [Frankia sp. EuI1c]
          Length = 823

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 23/172 (13%), Positives = 49/172 (28%), Gaps = 47/172 (27%)

Query: 25  ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK 84
            S          D       +     +       +      +       VSD R+K +++
Sbjct: 633 FSGWGFDGKFGPDNRRFWFQVGLFGWNVNDPQGGQQGGQAYIKGGEVYTVSDLRLKEDLR 692

Query: 85  PVAN-------LYQYRYLSDPKN------------------------------------- 100
            + +       L    Y  +                                        
Sbjct: 693 ELDDAGAIVRALRGVTYRWNEAGLRFQTRPLEERVGAGPTASEDEHAAVRAEVRESLLSG 752

Query: 101 ---VQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTA 149
               + +G+IAQE+  + P+ V     G++ +DYG+L  +     K++++T 
Sbjct: 753 LRGRREVGLIAQEVEAVMPELVGVGADGVRGIDYGKLTAVLVQAIKEQQSTI 804


>gi|257462745|ref|ZP_05627153.1| putative YapH protein [Fusobacterium sp. D12]
 gi|317060385|ref|ZP_07924870.1| predicted protein [Fusobacterium sp. D12]
 gi|313686061|gb|EFS22896.1| predicted protein [Fusobacterium sp. D12]
          Length = 542

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 45/120 (37%), Gaps = 9/120 (7%)

Query: 38  YAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV-------ANLY 90
           Y   +  +   +       +        +       +SD+R+K N++ +         L 
Sbjct: 417 YIPQSLGLSFAKQDTSVSFQNITASGDILAQGTVTGLSDKRLKQNIEKIQNPLKILKKLN 476

Query: 91  QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            Y +  +    + +GVIAQE+ K  P+ V E   G  SV YG +  +     K+     +
Sbjct: 477 GYTFTMN--KERHVGVIAQEVQKALPEAVRETENGYLSVAYGNMVGLLIETNKELLKRIE 534


>gi|301168297|emb|CBW27887.1| hypothetical protein BMS_3130 [Bacteriovorax marinus SJ]
          Length = 145

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 41/96 (42%), Gaps = 15/96 (15%)

Query: 70  LAPLVSDRRMKCNVKP-------VANLYQYRYLSDPKN--------VQRIGVIAQEISKI 114
                SD R K N+ P       +A+L  Y Y    +          ++IGV+AQE+  +
Sbjct: 36  DVFAGSDVRFKENINPLSDAMKGIASLNAYTYNYKTEEFPENKFSQREQIGVMAQELESV 95

Query: 115 RPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P  V E+ +G+K V+Y  L  I     K+     +
Sbjct: 96  FPQAVAEDEKGMKYVNYSMLTPILLEAVKELNKKVE 131


>gi|255037101|ref|YP_003087722.1| hypothetical protein Dfer_3346 [Dyadobacter fermentans DSM 18053]
 gi|254949857|gb|ACT94557.1| hypothetical protein Dfer_3346 [Dyadobacter fermentans DSM 18053]
          Length = 650

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 47/140 (33%), Gaps = 13/140 (9%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
           N +   +    +       +      Q       S            +N         SD
Sbjct: 469 NGSTAGIHFDNSQHQVDGFVGMKTDDQVGLYLGNSWMFWVDNGGTGYINNAIV---QTSD 525

Query: 77  RRMKCNVK-------PVANLYQYRYLSDPKNVQ---RIGVIAQEISKIRPDTVVENNQGI 126
           RR+K +          + +L  Y Y    K      + G+IAQE+ K+ P+ V  +++G 
Sbjct: 526 RRLKRDFVPLSSSLGKLTSLNGYHYFWKDKERDPSLQTGLIAQEVEKLFPELVKTDSKGF 585

Query: 127 KSVDYGRLFNIGQIQTKQKK 146
           KS++Y  L        K  K
Sbjct: 586 KSLNYTGLIPHLIEAVKSLK 605


>gi|42522291|ref|NP_967671.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39574822|emb|CAE78664.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1267

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 48/142 (33%), Gaps = 13/142 (9%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV- 74
                   +          A   Y+                G   F    +    LA  + 
Sbjct: 1067 SGDAYTTITNQSTAAGGQAWRWYSSSTGAPLGANAMCFGVGTCLFTLKTDGTAVLAGTLT 1126

Query: 75   --SDRRMKCNVKPVA-------NLYQYRYLSDP---KNVQRIGVIAQEISKIRPDTVVEN 122
              SDRR+K ++  +         +    Y        + + +G+IAQE+ K+ P+ V  +
Sbjct: 1127 QGSDRRLKRDIATINSALDSILQINGVTYNWIDPSKGDQREVGLIAQEVEKVFPEVVKTD 1186

Query: 123  NQGIKSVDYGRLFNIGQIQTKQ 144
             +G+KSV Y  L +      K+
Sbjct: 1187 AKGLKSVAYQNLVSPIIQAIKE 1208


>gi|221199531|ref|ZP_03572575.1| putative YapH protein [Burkholderia multivorans CGD2M]
 gi|221205568|ref|ZP_03578583.1| putative YapH protein [Burkholderia multivorans CGD2]
 gi|221174406|gb|EEE06838.1| putative YapH protein [Burkholderia multivorans CGD2]
 gi|221180816|gb|EEE13219.1| putative YapH protein [Burkholderia multivorans CGD2M]
          Length = 440

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 49/156 (31%), Gaps = 18/156 (11%)

Query: 8   FHEILSLMQNVTV----PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDA 63
            + I+ L  +  +          +         +   I       ++    +        
Sbjct: 274 MNGIVRLGNSRGIYFKRTDGTYHIAMQLTADSSNNTDIINCDGGGRIRFINDAYNAELGW 333

Query: 64  VNMGYQLAP-----LVSDRRMKCNVKPVA-------NLYQYRYLSD--PKNVQRIGVIAQ 109
            +              SDRR+K N+K +         L    +         + +G IAQ
Sbjct: 334 FDNNGNFWARGDIQGFSDRRVKSNIKRIKGAMAKVRELVGVTFTRRRSKDKTRHMGFIAQ 393

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
           ++  I P+ V  + +G+KS+ Y  +  +     K+ 
Sbjct: 394 DVEPIVPEVVHTDEKGMKSIAYANMTALLAEALKEL 429


>gi|42523560|ref|NP_968940.1| hypothetical protein Bd2088 [Bdellovibrio bacteriovorus HD100]
 gi|39575766|emb|CAE79933.1| hypothetical protein predicted by Glimmer/Critica [Bdellovibrio
            bacteriovorus HD100]
          Length = 1258

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/144 (19%), Positives = 48/144 (33%), Gaps = 12/144 (8%)

Query: 12   LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
             +   N+ V       +          A      + +  + ++         + +     
Sbjct: 1068 SAASANLDVYVPYEGSDGGKYFGYGYQASTGMFRFWDSTAGQRMNFTNSSGNMWIAGT-Y 1126

Query: 72   PLVSDRRMKCNVKPVA-------NLYQYRYLSDPKN----VQRIGVIAQEISKIRPDTVV 120
               SDRR K +++ +         +    Y   P       Q+IGVIAQE+  + P  V 
Sbjct: 1127 SNGSDRRFKTDIEVIPDALNKALQIQGVTYHWKPGVNPDPSQQIGVIAQEVETVFPQAVK 1186

Query: 121  ENNQGIKSVDYGRLFNIGQIQTKQ 144
             +  G KSV YG L        K+
Sbjct: 1187 TDADGYKSVTYGNLVAPLFNALKE 1210


>gi|92119284|ref|YP_579013.1| complement C1q protein [Nitrobacter hamburgensis X14]
 gi|91802178|gb|ABE64553.1| Complement C1q protein [Nitrobacter hamburgensis X14]
          Length = 781

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 46/156 (29%), Gaps = 21/156 (13%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
             + + I S+           +    +       A          +           +  
Sbjct: 597 NGSVNFIQSITTG-------NAAFPLSFYQGPGEAMRIDTNGNVGIGTTAPSYMLHVNGS 649

Query: 65  NMGYQLAPLVSDRRMKCNVKP-------VANLYQYRYLSDPKNV-----QRIGVIAQEIS 112
             G      +SDRR K N+ P       +  L    +            +++G+IAQE+ 
Sbjct: 650 VAGVGAYNALSDRRFKKNIHPADYGLAAIEKLRPVTFDWISPTSPQLHNRQLGLIAQEVQ 709

Query: 113 KIRPDTVV--ENNQGIKSVDYGRLFNIGQIQTKQKK 146
            + P+ V    +     S+ Y  L  +     ++ K
Sbjct: 710 PLVPEAVSVANDPSHTMSIAYSTLVPVLIKAVQELK 745


>gi|42523988|ref|NP_969368.1| phage related tail fibre protein [Bdellovibrio bacteriovorus HD100]
 gi|39576196|emb|CAE80361.1| phage related tail fibre protein [Bdellovibrio bacteriovorus HD100]
          Length = 1164

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 51/147 (34%), Gaps = 19/147 (12%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYAG----IAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
                     + L+N      +  AG    +  +     + +     K   +    G    
Sbjct: 973  AGSAGATSDVVLDNYNNRFRVLVAGAEQMVVASSGNVGVGQTSPSYKMHVNGTVAGTAAY 1032

Query: 72   PLVSDRRMKCNV-------KPVANLYQYRYLSDPKN--------VQRIGVIAQEISKIRP 116
               SD+R+K N+       + +  L    +    +            IGVIAQE+ K+ P
Sbjct: 1033 VNTSDQRLKKNITVIEGALEKILRLNGVYFDWRSEEYPDWNFEQRHDIGVIAQEVEKVFP 1092

Query: 117  DTVVENNQGIKSVDYGRLFNIGQIQTK 143
            + V  +++G K+V Y +L        K
Sbjct: 1093 EAVRTDDKGFKAVAYSKLVPPLIEAAK 1119


>gi|325185065|emb|CCA19557.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 965

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 43/116 (37%), Gaps = 16/116 (13%)

Query: 51  SERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP---------VANLY--QYRYLS--- 96
           S    G     D   MG       SD R K N+           ++ L   +Y + +   
Sbjct: 824 SSAYFGDGITVDGQVMGSGAYVDASDLRFKTNITYLTGGGSLHIISQLRAAEYNFKNATK 883

Query: 97  --DPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                  + IG IAQE+ K+ P  V E+ QG K V Y R+  +     K  +   Q
Sbjct: 884 WNKTHRKREIGFIAQEVEKVLPQVVTEDAQGFKYVAYARIIPVLTEGIKGLEAKVQ 939


>gi|149279316|ref|ZP_01885447.1| phage related tail fiber protein [Pedobacter sp. BAL39]
 gi|149229842|gb|EDM35230.1| phage related tail fiber protein [Pedobacter sp. BAL39]
          Length = 827

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/139 (19%), Positives = 44/139 (31%), Gaps = 7/139 (5%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
             +      + + +    +  +G                                  SDR
Sbjct: 671 SQLINDSGFITSVSMENYLPISGGEMQGPLTVQMNSPSTGVNLDVGGYARSFGFLTNSDR 730

Query: 78  RMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
            +K N+  +         L  Y Y         IG+IAQEI    P+ V  + +GI SVD
Sbjct: 731 SLKTNITRLGKSSEKLETLNGYSYQWKINKRNDIGMIAQEIKAAFPEAVFTDQKGILSVD 790

Query: 131 YGRLFNIGQIQTKQKKNTA 149
           YG+L        K+++   
Sbjct: 791 YGKLVAPLIEGHKEQQQQI 809


>gi|34419532|ref|NP_899545.1| long tail fiber distal subunit [Vibrio phage KVP40]
 gi|34333213|gb|AAQ64368.1| long tail fiber distal subunit [Vibrio phage KVP40]
          Length = 1094

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 55/150 (36%), Gaps = 14/150 (9%)

Query: 15   MQNVTVPKLPISLNNPTPIAPIDY---AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
            +   T   +  S N  + +   D                +        +Y          
Sbjct: 931  LGGDTTRYMQNSSNEGSWLFRSDNGKTWHFGARNTSWIHNSTDATSGFYYYQSIQSAGNI 990

Query: 72   PLVSDRRMKCNVK-------PVANLYQYRYL-SDPKNVQRIGVIAQEISKIRPDTVVE-- 121
               SD R+K NV+        +  L  Y Y  +D +  ++ GVIAQE+ ++ P+ VVE  
Sbjct: 991  TAYSDARVKTNVERITNPLEKIDRLNGYTYDRTDVECPRQTGVIAQEVLEVLPEAVVESG 1050

Query: 122  -NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             +  G  +V YG +  +     K++K   +
Sbjct: 1051 GDADGHYAVAYGNMVGLLIEGIKEEKRKRE 1080


>gi|42524640|ref|NP_970020.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39576850|emb|CAE78079.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1567

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/142 (16%), Positives = 52/142 (36%), Gaps = 16/142 (11%)

Query: 19   TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
             +      +      A  D A    N     +      +K F +  + G      +SD R
Sbjct: 1381 GLDGGNFWIRPGPTTATPD-AITVTNAGNVYIGGNTGSRKLFVNGTSGGTAAWENLSDAR 1439

Query: 79   MKCNVK-------PVANLYQYRYLSDPK--------NVQRIGVIAQEISKIRPDTVVENN 123
            +K +++        + +L    +               + +GVIAQ++ ++ P+ V ++ 
Sbjct: 1440 LKSDIEVIPDSLKKILSLRGVTFNWRHDVRPDLDLIEKKDMGVIAQDVERVFPEAVDKDE 1499

Query: 124  QGIKSVDYGRLFNIGQIQTKQK 145
            +G ++V Y +L        K+ 
Sbjct: 1500 KGFRAVAYTKLIGPMIEAFKEL 1521


>gi|284035117|ref|YP_003385047.1| hypothetical protein Slin_0183 [Spirosoma linguale DSM 74]
 gi|283814410|gb|ADB36248.1| hypothetical protein Slin_0183 [Spirosoma linguale DSM 74]
          Length = 1168

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 52/162 (32%), Gaps = 24/162 (14%)

Query: 13   SLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF---------YDA 63
             +    +     I  + PT  + ++    A       +     G             +  
Sbjct: 980  GVDNGASGNAYRIISSAPTTASAVNMELQAAGNANQLVLAATSGNVGIGTSAPSQKLHVV 1039

Query: 64   VNMGYQLAPLVSDRRMKCNVK-------PVANLYQYRYLSDPK--------NVQRIGVIA 108
             N+        SD R K NV         +  L    Y    +          ++IG IA
Sbjct: 1040 GNILASGTITPSDARFKENVATLNGSLAKLTQLRGVSYTHKAEFIKVRGLSAGKQIGFIA 1099

Query: 109  QEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            QE+ K  P+ VV +  G K+VDY RL  +     K+     Q
Sbjct: 1100 QELEKTFPEFVVTSADGYKAVDYARLTPVLVESLKEVNAKLQ 1141


>gi|149278064|ref|ZP_01884203.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
 gi|149231262|gb|EDM36642.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
          Length = 1026

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 50/143 (34%), Gaps = 11/143 (7%)

Query: 19  TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
            +     + N    +  +   G          +      +              + SD R
Sbjct: 849 NLGNHQAATNLKLGVYALSNDGTEGRGLTFNTAGDAFFAQNLTAHDVTVNGNFAIPSDER 908

Query: 79  MKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           +K N+K +             +Y+Y+         +IGVIAQE+ K+ P+ VV    G  
Sbjct: 909 LKTNIKTLTTVLQNLEQMRGVVYEYKDQHKYAAGPKIGVIAQELRKVYPEMVVMGADGFF 968

Query: 128 SVDYGRLFNIGQIQTKQKKNTAQ 150
            VDY +L  +     K+++   +
Sbjct: 969 KVDYTQLTGVLIQAVKEQQQQIE 991


>gi|167383335|ref|XP_001736494.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165901104|gb|EDR27264.1| hypothetical protein EDI_344700 [Entamoeba dispar SAW760]
          Length = 637

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/117 (17%), Positives = 42/117 (35%), Gaps = 8/117 (6%)

Query: 41  IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------VANLYQYR 93
           I +  +   +   +  K+                SD+R K ++         +  L    
Sbjct: 150 INEQNFIEIIQMSQALKQLHVIGEIFAENGFLTRSDQRTKTDIANLNNSLDLIMQLRGVT 209

Query: 94  YLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           +       ++ G IAQE+ ++ PD V E+ +G+  +D   +  I     K+     +
Sbjct: 210 FKYKGTEERKYGFIAQELKQVIPDLVREDEKGLY-IDTQGILPILVESLKELNQNVE 265


>gi|118197621|ref|YP_874014.1| distal tail fiber protein [Thermus phage phiYS40]
 gi|116266312|gb|ABJ91395.1| distal tail fiber protein [Thermus phage phiYS40]
          Length = 643

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 45/131 (34%), Gaps = 14/131 (10%)

Query: 27  LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV 86
           +N  T +          ++    ++       + +             SD R K N++P+
Sbjct: 505 VNGNTQLQGNLNVLGTTSLTTTYVNGILIVSGDVWIQ-----GTLYQTSDARFKTNLEPI 559

Query: 87  -------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQ 139
                    +  Y +       +  G+IAQE+  + P+ V  +  G   ++Y  +  +  
Sbjct: 560 QDALEKLGQITGYTFEMR--GKRLAGLIAQEVQNVLPEAVDVDQNGYLQLNYNAVVALLV 617

Query: 140 IQTKQKKNTAQ 150
              K+KK    
Sbjct: 618 EALKEKKKKID 628


>gi|304413928|ref|ZP_07395345.1| hypothetical protein REG_1014 [Candidatus Regiella insecticola
           LSR1]
 gi|304283648|gb|EFL92043.1| hypothetical protein REG_1014 [Candidatus Regiella insecticola
           LSR1]
          Length = 414

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 49/156 (31%), Gaps = 15/156 (9%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           + I  +             +         Y  +  N+Y  +   +        +   +  
Sbjct: 250 NGI-RITDGAASVHWDAEASAFYRYNQFWYLSVDNNLYFRKKGAKNVAFHFDIETATLRA 308

Query: 69  QLAPLVSDRRMKCNVK-------PVANLYQYRYLSDPK-------NVQRIGVIAQEISKI 114
                 SDRR+K ++K        +  L    Y               +IG+IA E+   
Sbjct: 309 NKFQQASDRRLKTHIKPLGPVLGKILQLQGIYYDWSDHSRTKDYIKEPQIGLIADELQAS 368

Query: 115 RPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P+ V  +    K VDYGR   +     KQ++   +
Sbjct: 369 FPELVACDQDNFKYVDYGRFTAVLLEAVKQQQQMIE 404


>gi|256424225|ref|YP_003124878.1| carbohydrate-binding protein [Chitinophaga pinensis DSM 2588]
 gi|256039133|gb|ACU62677.1| Carbohydrate-binding family V/XII [Chitinophaga pinensis DSM 2588]
          Length = 562

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 11/72 (15%), Positives = 31/72 (43%), Gaps = 5/72 (6%)

Query: 83  VKPVANLYQYRYLSD-----PKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
           +  V  L    +  +     P N  +IG +  ++ +  P+ V  +  G +++ Y  +  +
Sbjct: 478 IDKVKRLNPITFNFNQKANCPSNESQIGFLPHQVEEFFPELVNTDGDGTQTLAYANMVAV 537

Query: 138 GQIQTKQKKNTA 149
                +++++T 
Sbjct: 538 LTKAIQEQQDTI 549


>gi|313675512|ref|YP_004053508.1| hypothetical protein Ftrac_1410 [Marivirga tractuosa DSM 4126]
 gi|312942210|gb|ADR21400.1| hypothetical protein Ftrac_1410 [Marivirga tractuosa DSM 4126]
          Length = 659

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 10/84 (11%)

Query: 76  DRRMKCNVKPVAN-------LYQYRYLSDPKN---VQRIGVIAQEISKIRPDTVVENNQG 125
           DRR+K N+  + N       L    Y    +N    ++IG+IAQE+ ++ P+ V  + +G
Sbjct: 536 DRRLKKNISTLENSLANTLRLRGTTYYWKNENSSTERQIGLIAQEVEEVYPEFVHTDAEG 595

Query: 126 IKSVDYGRLFNIGQIQTKQKKNTA 149
            KSV+Y ++  +     K+     
Sbjct: 596 KKSVNYSQMTAVLIEAIKELNAKV 619


>gi|92119290|ref|YP_579019.1| hypothetical protein Nham_3856 [Nitrobacter hamburgensis X14]
 gi|91802184|gb|ABE64559.1| hypothetical protein Nham_3856 [Nitrobacter hamburgensis X14]
          Length = 461

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 49/157 (31%), Gaps = 22/157 (14%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIA------QNIYQNQLSERKEGKKEFYDAVN 65
             L    T        +     + ID            N   N               ++
Sbjct: 272 TGLHLGSTTNAFLYPDSGAAYNSGIDIYKTGARKWVLYNQGNNDNFYILGSDGSSGVYLS 331

Query: 66  MGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
            G       SD R+K N++ +  L         ++         +GVIAQE+ KI P+ V
Sbjct: 332 QGATSWSASSDIRLKKNIETLRVLDRLDGYRAVQFNWKQSGKHDLGVIAQELYKIFPEVV 391

Query: 120 VENNQ----------GIKSVDYGRLFNIGQIQTKQKK 146
            + +           G+ SV Y +L  +     K+ K
Sbjct: 392 NKGSDSGTVEKMNDKGVWSVQYDKLGALALEAVKELK 428


>gi|124010598|ref|ZP_01695214.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
 gi|123982213|gb|EAY23814.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
          Length = 369

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 28/157 (17%), Positives = 55/157 (35%), Gaps = 25/157 (15%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQ---------NIYQNQLSERKEGKKEFYDAVNMG 67
            ++       L      A  +YAG  +          I     + + E     +    + 
Sbjct: 144 GISFHTAGGVLTGDVITAGQNYAGYERMRIDLNGNVGIGTTTPAYKLEVDGNIHATERVY 203

Query: 68  YQLAPLVSDRRMKCNVK--------PVANLYQYRYLSDPK--------NVQRIGVIAQEI 111
                L SD R K N++         ++ +    Y    +          +++G+IAQE+
Sbjct: 204 ANGIELTSDIRYKKNIQPLSTDVVAKLSQVRGTSYKFRTEEFKEKRFLKTKQVGIIAQEL 263

Query: 112 SKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNT 148
           +++ P+ V++   G  SV+Y  L  I     K  +  
Sbjct: 264 AQVYPELVMKGADGYYSVNYIGLIPILVEAVKDLRKN 300


>gi|67475526|ref|XP_653457.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56470408|gb|EAL48071.1| hypothetical protein EHI_072090 [Entamoeba histolytica HM-1:IMSS]
          Length = 640

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 42/122 (34%), Gaps = 8/122 (6%)

Query: 36  IDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------VAN 88
                I +  +   +   +  K+                SD+R K ++         +  
Sbjct: 148 NTEDSINEQNFIEIIQMSQALKQLHVIGEIFAENGFLTRSDQRTKTDIANLNNSLDLIMQ 207

Query: 89  LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNT 148
           L    +       ++ G IAQE+ ++ PD V E+ QG+  +D   +  I     KQ    
Sbjct: 208 LRGVTFKYKGTEQRKYGFIAQELKQVLPDLVREDTQGLY-IDTQGILPILVESLKQLNQN 266

Query: 149 AQ 150
            +
Sbjct: 267 VE 268


>gi|124004568|ref|ZP_01689413.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123990140|gb|EAY29654.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 341

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 47/155 (30%), Gaps = 36/155 (23%)

Query: 32  PIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA---- 87
                +Y    ++     +            A           SD+R+K N+ P+     
Sbjct: 73  TPYTANYVLFLRDDNHIGMGTSGSNAYRLDVAGTARSTGWYTTSDKRLKSNINPIEGSLT 132

Query: 88  ---NLYQYRYL-----------------------------SDPKNVQRIGVIAQEISKIR 115
               L    Y                                 K  QR+G IAQ++ ++ 
Sbjct: 133 KLLQLKGVSYQYTFELNKYGDLSGEKITEIKQKTIDADKPYTSKAKQRLGFIAQDLQQVL 192

Query: 116 PDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           P+ V ++ +G  SV+Y  +  +     K+++    
Sbjct: 193 PEAVAKDEKGFLSVNYSEVVPLLVEAMKEQQAKID 227


>gi|124002008|ref|ZP_01686862.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
 gi|123992474|gb|EAY31819.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
          Length = 617

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 46/151 (30%), Gaps = 16/151 (10%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           + +              +  N   +     +G    +  +      +          +  
Sbjct: 435 NSVGDYQSGAGAVVFDANGGNMYFLISGHSSGKDTPVNWDGSILTLQRGGNATFKGMVSA 494

Query: 69  QLAPLVSDRRMKCNVKPV--------ANLYQYRYLSDPKN--------VQRIGVIAQEIS 112
             + L SD R K ++ P+          L    Y                ++G IAQE+ 
Sbjct: 495 NGSQLYSDARFKKDITPITTGLIAKLDQLQGNTYQWRNDEFTERNFVEGTQLGFIAQEMQ 554

Query: 113 KIRPDTVVENNQGIKSVDYGRLFNIGQIQTK 143
           ++ P+ V  ++ G  S++Y  L  +     K
Sbjct: 555 EVFPELVSADSDGYLSINYTGLIPVLTEAHK 585


>gi|167377056|ref|XP_001734269.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904350|gb|EDR29592.1| hypothetical protein EDI_210770 [Entamoeba dispar SAW760]
          Length = 674

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 57/164 (34%), Gaps = 17/164 (10%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPI-SLNNPTPIAPIDYAGIAQNIYQNQLSE------R 53
           + Q    F  + +   N  +  + I           I+      +  Q+           
Sbjct: 164 ITQNNYPFSFLPTHQINNQIESVKIEQPFQSATTIAIEEINQINSNIQDNTEFIKIEEIT 223

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL---------YQYRYLSDPKNVQRI 104
            + K+              + SD R K +++ + N           +Y Y ++P N  + 
Sbjct: 224 NQIKRLHVFGEIFAENGYFVRSDVRSKTDIQIIENALNSILSLVGKKYSYKNEP-NKVKY 282

Query: 105 GVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNT 148
           G IAQE+ K+ P+ V +++ G  SVDY  +        K   + 
Sbjct: 283 GFIAQEVQKVIPNLVQKDDTGNLSVDYLGIIPYIIEALKSIHDN 326


>gi|61805905|ref|YP_214265.1| fiber [Prochlorococcus phage P-SSM2]
 gi|61374414|gb|AAX44411.1| fiber [Prochlorococcus phage P-SSM2]
 gi|265525112|gb|ACY75909.1| predicted protein [Prochlorococcus phage P-SSM2]
          Length = 1908

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 48/149 (32%), Gaps = 12/149 (8%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
            L  +  +            I         ++    +      G K            A  
Sbjct: 1757 LRSDANIEIGNKDGTEQGLIYTAGAGIKLRHGTTLRFETNTSGAKVHGALEVTDDITAYS 1816

Query: 74   VSDRRMKCNVKPVANL---------YQYRYLS--DPKNVQRIGVIAQEISKI-RPDTVVE 121
             SD R+K +VKP+ +            + +      +  +  GVIAQEIS I  P TV  
Sbjct: 1817 TSDARLKNDVKPIQDSLAKVNSISGNTFTWNEASKKEGQEDTGVIAQEISAIGLPGTVTI 1876

Query: 122  NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
               G  +VDY +L  +     K+  N   
Sbjct: 1877 REDGTYAVDYEKLVPLLLEAIKELSNKVD 1905


>gi|301167377|emb|CBW26959.1| putative membrane-anchored cell surface protein [Bacteriovorax
            marinus SJ]
          Length = 1915

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 49/153 (32%), Gaps = 16/153 (10%)

Query: 11   ILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE-FYDAVNMGYQ 69
            I     +       +     T ++P +   +       ++        E      N+   
Sbjct: 1701 ISRQTNSNGTGDGSLRFTYGTDVSPTENPAMVTFETNGRVGIGTVDPSEQLEVNGNVKAA 1760

Query: 70   LAPLVSDRRMKCNVK-------PVANLYQYRYLSDPKN--------VQRIGVIAQEISKI 114
                 SD+R K N+         V  L    +               +  G IAQE+ ++
Sbjct: 1761 SYLYTSDKRFKKNITLVEAPLAKVDALRGVLFDWRNDEYNDLNLPEGRDYGFIAQEVEEV 1820

Query: 115  RPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKN 147
             P+ V  ++ G KSV Y  + +I     K  K+
Sbjct: 1821 APELVHTDDFGYKSVKYANITSILVEAVKSLKD 1853


>gi|255037099|ref|YP_003087720.1| hypothetical protein Dfer_3344 [Dyadobacter fermentans DSM 18053]
 gi|254949855|gb|ACT94555.1| hypothetical protein Dfer_3344 [Dyadobacter fermentans DSM 18053]
          Length = 397

 Score = 71.3 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 49/140 (35%), Gaps = 13/140 (9%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKE---GKKEFYDAVNMGYQLAPL 73
           N +   +    +    +  +  +G     +      + +         +       +   
Sbjct: 209 NGSTAGIYFDNSQHNSVGFVGMSGDNSIGFYIGNDWKLQVYGNGGTLINGNLGVNGIISE 268

Query: 74  VSDRRMKCNV-------KPVANLYQYRYLSDPKNVQR---IGVIAQEISKIRPDTVVENN 123
            SDRR+K +        + ++ L  Y Y    K   +    G+IAQ++  + P+ V  + 
Sbjct: 269 SSDRRLKRDFSPLSTSFEKLSKLEGYHYYWKDKERDQSLQTGLIAQDVETLFPELVKTDA 328

Query: 124 QGIKSVDYGRLFNIGQIQTK 143
           +G KS++Y  L        K
Sbjct: 329 KGFKSLNYTGLIPHLIESVK 348


>gi|124002007|ref|ZP_01686861.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
 gi|123992473|gb|EAY31818.1| cell wall surface anchor family protein, putative [Microscilla
           marina ATCC 23134]
          Length = 609

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 47/149 (31%), Gaps = 16/149 (10%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
            T      +      +  +      Q            G         +      L SD 
Sbjct: 430 ATKVSFGGAGTRYGAVWWVPGLNEFQFTQSTNNWFGGAGYYASIRGNAIYSNSTQLTSDI 489

Query: 78  RMKCNVKPV--------ANLYQYRYLSDPKN--------VQRIGVIAQEISKIRPDTVVE 121
           R K ++ P+          L    Y    +           ++G IAQE+ ++ P+ V E
Sbjct: 490 RFKKDIMPITHEVIAKLGQLQGNTYQWRTEEFKNRDFAEGTQLGFIAQEMQEVYPELVNE 549

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           ++QG  S++Y  L  +     K   N ++
Sbjct: 550 DHQGDLSINYTGLIPVLTEALKDLNNKSE 578


>gi|150396294|ref|YP_001326761.1| hypothetical protein Smed_1074 [Sinorhizobium medicae WSM419]
 gi|150027809|gb|ABR59926.1| hypothetical protein Smed_1074 [Sinorhizobium medicae WSM419]
          Length = 284

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 70  LAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
            A   SDRR+K ++  +A L      Y++RYL    +   +GV+AQE+ ++ P+ VV  +
Sbjct: 180 DANEASDRRLKRDIARLAELANGLGVYRFRYLW--SDEVFVGVMAQEVLEVMPEAVVIGS 237

Query: 124 QGIKSVDYGRLFNIGQIQTKQ 144
            G   V+Y +L  I  +  +Q
Sbjct: 238 DGYMRVNYTKL-GIEMLSLEQ 257


>gi|225855800|ref|YP_002737311.1| hypothetical protein SPP_0076 [Streptococcus pneumoniae P1031]
 gi|225724622|gb|ACO20474.1| hypothetical protein SPP_0076 [Streptococcus pneumoniae P1031]
          Length = 140

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 37/112 (33%), Gaps = 14/112 (12%)

Query: 53  RKEGKKEFYDAVNMGYQLAPL--VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQ 102
                  +++ V  G     +   SDRR+K N+          +  L    +        
Sbjct: 22  GGRNAVVWWNQVGSGSVKYWMEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKH 81

Query: 103 R-IGVIAQEISKIRPDTVV---ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             IG+IAQE   I P  V    EN  G   +DY  L        ++     +
Sbjct: 82  EEIGLIAQEAETIVPRIVSRDPENPDGYLHIDYTALVPYLIKAIQELNQKIE 133


>gi|67477993|ref|XP_654427.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471466|gb|EAL49035.1| hypothetical protein EHI_083660 [Entamoeba histolytica HM-1:IMSS]
          Length = 698

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 54/168 (32%), Gaps = 26/168 (15%)

Query: 1   MDQKQQAFHEILSLMQNVT--VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK 58
           + +    F  +     N         IS  +         A IA      Q     +   
Sbjct: 179 LSESNYPFAFLSEYQFNNQFITNNYHISPTDQPIQQFQPTATIAIEETNQQNPNIIQDNS 238

Query: 59  EFYDAVNMGY--------------QLAPLVSDRRMKCNVKPVANL---------YQYRYL 95
           +F     +                    + SD R K +++ + N           +Y Y 
Sbjct: 239 DFIKIEQITTQLKRLHVFGEIFAENGYLVRSDARSKTDIQTIENALNSVTSLVGKKYAYK 298

Query: 96  SDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTK 143
           ++P N  + G IAQE+ ++ PD V ++  G  SVDY  +        K
Sbjct: 299 NEP-NKIKYGFIAQEVQEVIPDLVQKDESGNLSVDYLGVIPYIVEALK 345


>gi|291335322|gb|ADD94939.1| hypothetical protein [uncultured phage MedDCM-OCT-S01-C29]
          Length = 354

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/166 (13%), Positives = 48/166 (28%), Gaps = 24/166 (14%)

Query: 9   HEILSLMQNVTVPKLPISLNN--PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
           +             +  S N      +A ++            ++    G  +       
Sbjct: 177 NFYYRRDNGSQAGTIIASNNADRGWSLAYLNKFSWNTGDDARFINFYLNGAGQDSITWTG 236

Query: 67  GYQLAPLVSDRRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPD 117
                   SD R K N              ++ +Y ++  P+  + +G  A E+ +I P 
Sbjct: 237 SAINYGTSSDYRRKTNPSTYTGAFEKVKQLHVREYNWIEFPEAGRTVGFFAHELQEIFPQ 296

Query: 118 TVVENNQGIK-------------SVDYGRLFNIGQIQTKQKKNTAQ 150
            V     G+K              +DYG++  +     ++     +
Sbjct: 297 AVTGVKDGMKIDEFTGEEVPDYQGIDYGKITPLLAAALQEAIAKIE 342


>gi|126443127|ref|YP_001063336.1| hypothetical protein BURPS668_A2342 [Burkholderia pseudomallei 668]
 gi|126222618|gb|ABN86123.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
          Length = 408

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 33/139 (23%), Positives = 55/139 (39%), Gaps = 12/139 (8%)

Query: 5   QQAFHEILSLMQ----NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           Q  F ++ +L      N    +   S  N        YAG     Y   ++         
Sbjct: 268 QLPFSQLATLASLVPGNTGTAQSASSPANIAQAFQNQYAGQLNQ-YNTGVASANSTMGGL 326

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVA------NLYQYRYLSDPKNVQRIGVIAQEISKI 114
           +        +  L+SDRR K ++  +       N Y++RY  +     R G++A E+ ++
Sbjct: 327 FGLG-SAGLMGFLLSDRRSKTDIHAIGPAGDGVNFYRFRYRWEAPGTVRHGLMADEVKRV 385

Query: 115 RPDTVVENNQGIKSVDYGR 133
           RPD VV +  G   V+Y R
Sbjct: 386 RPDAVVRHPSGYDLVNYNR 404


>gi|42523208|ref|NP_968588.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39575413|emb|CAE79581.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1365

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/144 (19%), Positives = 48/144 (33%), Gaps = 12/144 (8%)

Query: 12   LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
            ++L        L    +    I   + A +   I  N                 +     
Sbjct: 1170 IALAIGDQDTGLEWVTDGVLQIYSNNAARMHFAINGNVGIGTTTPGYRLDVNGTLRGFGI 1229

Query: 72   PLVSDRRMKCNV---------KPVANLYQYRYLSDP---KNVQRIGVIAQEISKIRPDTV 119
               SD R+K ++         + +  +    Y           ++G IAQE+ KI P+ V
Sbjct: 1230 TDSSDIRLKRDIASLSSSEALQRILKIQGVSYNWKNPEYGKRPQLGFIAQELEKIYPELV 1289

Query: 120  VENNQGIKSVDYGRLFNIGQIQTK 143
              + QG+KSV+Y  L +      K
Sbjct: 1290 ETDPQGMKSVNYSHLVSPLVEAIK 1313


>gi|163755841|ref|ZP_02162959.1| phage related tail fibre protein [Kordia algicida OT-1]
 gi|161324362|gb|EDP95693.1| phage related tail fibre protein [Kordia algicida OT-1]
          Length = 683

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 23/169 (13%), Positives = 50/169 (29%), Gaps = 25/169 (14%)

Query: 7   AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAG-----IAQNIYQNQLSERKEGKKEFY 61
           +   I +  Q+         L        ++         +    +  ++          
Sbjct: 472 SVARISAGDQSTGTANGNKYLGFQVGRNKLNSDTKLMYLSSVGGGRVGINTESPSYTLHV 531

Query: 62  DAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRYLSDP----------KNVQRI 104
           +    G       SD R+K N+         + +L    +  +            +   I
Sbjct: 532 NGSVAGTSAYVNTSDARLKTNILPLENALSKIMSLQGVTFDWNSNRSVGKQLELDDKNHI 591

Query: 105 GVIAQEISKIRPDTVVENN---QGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           G IAQ++  + P+ V  ++   + IKSV Y  +  +     K+      
Sbjct: 592 GFIAQQVESVLPEVVSTDDSSSEKIKSVAYADIVPVLVEAIKELNKKID 640


>gi|183234067|ref|XP_652532.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169801272|gb|EAL47144.2| hypothetical protein EHI_112040 [Entamoeba histolytica HM-1:IMSS]
          Length = 559

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 53/150 (35%), Gaps = 14/150 (9%)

Query: 6   QAFHEILS-LMQNVTVPKLPISLNNPTPIAPID-YAGIAQNIYQNQLSERKEGKKEFYDA 63
           Q  ++I     QN  V    + LN  T            +  Y NQ   R     E +  
Sbjct: 151 QISNQIPHQYTQNDNVSGDRVVLNPITYELINSCGEDFIRIYYINQNIRRLHVFGEIF-- 208

Query: 64  VNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRP 116
                      SD+R K ++K ++N       L    Y       +R G IAQE+ ++ P
Sbjct: 209 ---AENGFLQRSDQRYKKDIKKISNALEKVLLLTGRSYKYLNDKQRRFGFIAQELKEVIP 265

Query: 117 DTVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
           + V E+  G  S+D   L        K+  
Sbjct: 266 EAVKEDEDGTLSIDPLALLPFIIESLKELN 295


>gi|67478100|ref|XP_654472.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471518|gb|EAL49082.1| hypothetical protein EHI_006740 [Entamoeba histolytica HM-1:IMSS]
          Length = 692

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
              QQ  +EI      +  P  P++      I         +    N+  +R     E  
Sbjct: 215 TSPQQPQNEIP--WDYLQSPSTPLTPTQMNGIIEK-NEDFIRIERINENLKRLHVMGEIM 271

Query: 62  DAVNMGYQLAPLVSDRRMKCNVKP-VANLYQY------RYLSDPKNVQRIGVIAQEISKI 114
                        SD R+K N+KP V +L          +    K  +++G IAQE+ K+
Sbjct: 272 -----AENGFLQRSDIRVKENIKPLVDSLNTVLQLTGTSFNYIGKKEEKLGFIAQEVKKV 326

Query: 115 RPDTVVENNQGIKSVDYGRLFNIGQIQTKQ 144
            P+ V+E+++G  +VD   +        KQ
Sbjct: 327 CPELVIEDDKGELAVDVIGVIPHLVEALKQ 356


>gi|167907339|ref|ZP_02494544.1| hypothetical protein BpseN_34235 [Burkholderia pseudomallei NCTC
           13177]
          Length = 399

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/139 (23%), Positives = 56/139 (40%), Gaps = 12/139 (8%)

Query: 5   QQAFHEILSLMQ----NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           Q  F ++ +L      N    +   S  N        YAG     Y   ++         
Sbjct: 259 QLPFSQLATLASLVPGNTGTAQSASSPANIAQAFQNQYAGQLNQ-YNTGVASANSTMGGL 317

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLSDPKNVQRIGVIAQEISKI 114
           +        +  L+SDRR K ++  + ++      Y++RY  +     R G++A E+ ++
Sbjct: 318 FGLG-SAGLMGFLLSDRRSKTDIHAIGSVGDGVNFYRFRYRWEAPGTVRHGLMADEVKRV 376

Query: 115 RPDTVVENNQGIKSVDYGR 133
           RPD VV +  G   V+Y R
Sbjct: 377 RPDAVVRHPSGYDLVNYNR 395


>gi|67478702|ref|XP_654733.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471804|gb|EAL49347.1| hypothetical protein EHI_194560 [Entamoeba histolytica HM-1:IMSS]
          Length = 562

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 47/133 (35%), Gaps = 7/133 (5%)

Query: 21  PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
            +   S N               N +    S  +  K+ +              SD+R K
Sbjct: 166 TQFGQSSNGIMVTPFTSQLLSLGNDFIRIYSISQNVKRLYVAGEIFAENGFLQRSDKRSK 225

Query: 81  CNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGR 133
            ++K +++       +    +    ++  R G IAQE+ ++ P+ V E+  G  S+D   
Sbjct: 226 KDIKKISHALDTICKITGKSFKYVNEDRTRFGFIAQELKEVIPEAVKEDEDGRLSIDPLS 285

Query: 134 LFNIGQIQTKQKK 146
           L        K+ +
Sbjct: 286 LLPFIVESLKELQ 298


>gi|124002006|ref|ZP_01686860.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
 gi|123992472|gb|EAY31817.1| cell wall surface anchor family protein [Microscilla marina ATCC
           23134]
          Length = 502

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 34/93 (36%), Gaps = 16/93 (17%)

Query: 74  VSDRRMKCNVKPV--------ANLYQYRYLS--------DPKNVQRIGVIAQEISKIRPD 117
            SD R K ++ P+          L    +          +     +IG IAQE+  + P+
Sbjct: 390 SSDLRFKKDITPITSEAITKLGQLQGKTFQWRTEEFKEKNFSEGTKIGFIAQEMLNVYPE 449

Query: 118 TVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            V E   G  S++Y  L  I     K   N  +
Sbjct: 450 LVNEGGDGYYSINYSGLIPILTEAVKDLNNKNE 482


>gi|262067974|ref|ZP_06027586.1| putative phage tail fiber repeat-containing domain protein
           [Fusobacterium periodonticum ATCC 33693]
 gi|291378375|gb|EFE85893.1| putative phage tail fiber repeat-containing domain protein
           [Fusobacterium periodonticum ATCC 33693]
          Length = 892

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 43/139 (30%), Gaps = 8/139 (5%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
             N             T     +      +           G                L 
Sbjct: 740 SSNSPNDNAGGVDFGYTQDNTFNRTSFISSSGVGSFKMITTGSDVNVGRNIKLSGDLFLT 799

Query: 75  SDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
           SDRR+K  +       + ++ L  Y +  +    +  G+IAQE+ ++ P+ V E    I 
Sbjct: 800 SDRRIKREIKKVDNALEKISKLNGYTFYKEGFKNKTAGIIAQEVKEVFPELVNE-KNNIL 858

Query: 128 SVDYGRLFNIGQIQTKQKK 146
            V+Y  L ++     K+  
Sbjct: 859 EVNYNGLHSLLIEAIKELN 877


>gi|167380892|ref|XP_001735496.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165902496|gb|EDR28300.1| hypothetical protein EDI_244320 [Entamoeba dispar SAW760]
          Length = 692

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 56/147 (38%), Gaps = 15/147 (10%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
           QQ  +EI      +  P  P++      +         +    N+  +R     E     
Sbjct: 218 QQPQNEIP--WDYLQSPSTPLTPTQMNGVIEK-NEDFIRIERINENLKRLHVMGEIM--- 271

Query: 65  NMGYQLAPLVSDRRMKCNVKP-VANLYQY------RYLSDPKNVQRIGVIAQEISKIRPD 117
                     SD R+K N+KP V +L          +    K  +++G IAQE+ K+ P+
Sbjct: 272 --AENGFLQRSDIRVKENIKPLVDSLNTVLQLTGTSFNYIGKKEEKLGFIAQEVKKVCPE 329

Query: 118 TVVENNQGIKSVDYGRLFNIGQIQTKQ 144
            V+E+ +G  +VD   +        KQ
Sbjct: 330 LVIEDEKGELAVDVIGVIPHLVEALKQ 356


>gi|298713329|emb|CBJ33556.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 759

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 51/150 (34%), Gaps = 28/150 (18%)

Query: 21  PKLPISLNNPTPIAP---IDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
           P L  ++       P   +   G++ +   +  S+             MG       SD 
Sbjct: 473 PGLNFTMGGGVSGLPSLSVGDGGLSVDGVLSTASDVMIEGSVTVSGAVMGRGPYMDTSDA 532

Query: 78  RMKCNVKPV---------ANLYQYRYLSDP----------------KNVQRIGVIAQEIS 112
           RMK  VK +           L    Y+  P                 + ++ G IAQE+ 
Sbjct: 533 RMKMEVKDISASDAMAVMKGLRAVTYVLKPEALLASKARNSQTRTHGDRRQHGFIAQEVE 592

Query: 113 KIRPDTVVENNQGIKSVDYGRLFNIGQIQT 142
           ++ P+ V E++ G K+V Y RL        
Sbjct: 593 QVAPEVVAEDSNGYKTVAYSRLVPTLATAL 622


>gi|332667272|ref|YP_004450060.1| hypothetical protein Halhy_5362 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332336086|gb|AEE53187.1| hypothetical protein Halhy_5362 [Haliscomenobacter hydrossis DSM
           1100]
          Length = 271

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 45/152 (29%), Gaps = 43/152 (28%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA-------NLYQYRY 94
             N    Q          F     +      L SD R+K NVK +         L    Y
Sbjct: 108 VTNGMAFQWVAGSTNAWVFDIWGQVRSYGITLTSDIRLKSNVKKIDNGLTLVKQLNGISY 167

Query: 95  LSDPK------------------------------------NVQRIGVIAQEISKIRPDT 118
             +                                         ++G  AQ++ KI P  
Sbjct: 168 DFNKPISAERIKLLADAVPNSEKERQEIEKERNKLAEESKPQKDQLGFSAQDVQKILPQL 227

Query: 119 VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           V ++ QG+ SV+Y  +  +     K+++ T +
Sbjct: 228 VTQDEQGMLSVNYIGMIPVLVEAIKEQQTTIE 259


>gi|323137875|ref|ZP_08072950.1| hypothetical protein Met49242DRAFT_2338 [Methylocystis sp. ATCC
           49242]
 gi|322396878|gb|EFX99404.1| hypothetical protein Met49242DRAFT_2338 [Methylocystis sp. ATCC
           49242]
          Length = 526

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 75  SDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
           SD R+K  V  +  L      YR++ +      +GV+AQE+ K+ P  V     G   V 
Sbjct: 441 SDLRLKHAVTLLGRLDNGLGFYRFIYNGGEKAFVGVMAQEVQKVMPQAVWRAPDGYLRVA 500

Query: 131 YGRL 134
           Y ++
Sbjct: 501 YDKV 504


>gi|307565665|ref|ZP_07628138.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
 gi|307345628|gb|EFN90992.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
          Length = 312

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 35/109 (32%), Gaps = 27/109 (24%)

Query: 69  QLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDPKNVQ------------------- 102
                 SD R K NVK +        NL    Y                           
Sbjct: 99  ANVYNYSDERAKTNVKTIDGGLNTILNLRPVSYTWKSGIGSATRSSHLMTVANGPSCDKN 158

Query: 103 -RIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            + G +AQE+ ++ PD V  + +G K ++Y  +  I     +  +   +
Sbjct: 159 LQFGFLAQELEEVIPDAVKTDEEGRKLINYTAIIPILVKSIQDLQGKVE 207


>gi|298376506|ref|ZP_06986461.1| carbohydrate binding domain-containing protein [Bacteroides sp.
            3_1_19]
 gi|298266384|gb|EFI08042.1| carbohydrate binding domain-containing protein [Bacteroides sp.
            3_1_19]
          Length = 1242

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 49/148 (33%), Gaps = 21/148 (14%)

Query: 17   NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
                P L + ++N   I   +  G   N+Y                 V +        SD
Sbjct: 1090 GGRYPFLGVRIDNGNGIYGWNSPGNIANLY-------INKDAASTAHVYITNYQGLTSSD 1142

Query: 77   RRMKCNVKPVAN-------LYQYRYLSDPKNVQ--RIGVIAQEISKIRPDTVV----ENN 123
             R+K     + +       +  + Y       +  RIGV AQ + ++ P+ V     +++
Sbjct: 1143 IRLKSVFFDIPDVLDKLEGISAFYYTMKEDEDKILRIGVSAQAVREVLPEAVHLITPDDD 1202

Query: 124  QGIKSVDYGR-LFNIGQIQTKQKKNTAQ 150
                 VDY + L   G    K+     +
Sbjct: 1203 DSYYGVDYIQMLTAFGINGIKELHAKVK 1230


>gi|301101960|ref|XP_002900068.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262102643|gb|EEY60695.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 946

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 35/105 (33%), Gaps = 16/105 (15%)

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDP-------- 98
             G     D   MG       SD R K ++  +         L    Y  +         
Sbjct: 839 FFGASVTVDGQVMGSGAYVDASDERFKRDIHQITNASDVVAQLRGVEYAYNSAEFPSKFP 898

Query: 99  -KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQT 142
               + +G IAQE+ K  P  V  +  G K V Y RL  + +  T
Sbjct: 899 LDGRRELGFIAQEVEKAAPQVVSTDADGFKYVAYARLMPVVREAT 943


>gi|167393690|ref|XP_001740677.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165895125|gb|EDR22899.1| hypothetical protein EDI_021390 [Entamoeba dispar SAW760]
          Length = 630

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 8/88 (9%)

Query: 69  QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
                 SD R+K ++         + NL    +  + K+ + +G IAQE+ ++ P+ V E
Sbjct: 218 NGFLQRSDARVKEHIEPLKGCLDKILNLTGKSFNYNGKDEKNLGFIAQEVQEVCPELVHE 277

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQKKNTA 149
           +  G  SVD   +  I     K+  + A
Sbjct: 278 DEFG-LSVDVIGIIPILVEALKEINSAA 304


>gi|321157252|emb|CBW39235.1| PblB-type protein [Streptococcus phage 2167]
          Length = 1469

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 46/152 (30%), Gaps = 15/152 (9%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYA-GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
               +        +  + +P+       G    +      +       +++ V  G     
Sbjct: 1311 FSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYW 1370

Query: 73   L--VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV- 120
            +   SDRR+K N+          +  L    +          IG+IAQE   I P  V  
Sbjct: 1371 MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSR 1430

Query: 121  --ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              EN  G   +DY  L        ++     +
Sbjct: 1431 DPENPDGYLHIDYTALVPYLIKAIQELNQKIE 1462


>gi|169833508|ref|YP_001693486.1| hypothetical protein SPH_0062 [Streptococcus pneumoniae Hungary19A-6]
 gi|168996010|gb|ACA36622.1| PblB [Streptococcus pneumoniae Hungary19A-6]
          Length = 3038

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 46/152 (30%), Gaps = 15/152 (9%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYA-GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
               +        +  + +P+       G    +      +       +++ V  G     
Sbjct: 2880 FSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYW 2939

Query: 73   L--VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV- 120
            +   SDRR+K N+          +  L    +          IG+IAQE   I P  V  
Sbjct: 2940 MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSR 2999

Query: 121  --ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              EN  G   +DY  L        ++     +
Sbjct: 3000 DPENPDGYLHIDYTALVPYLIKAIQELNQKIE 3031


>gi|261879742|ref|ZP_06006169.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270333616|gb|EFA44402.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 204

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 45/137 (32%), Gaps = 22/137 (16%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
              +   G     + +Q+         F              SD R K N++        
Sbjct: 65  QIDVSPVGTRLASHADQVVFYNTQTSTFNSIQVK---DVYNYSDARAKSNIRSLQNGLNC 121

Query: 86  VANLYQYRYLS------------DPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGR 133
           +  L    Y                 + + IG++AQE+ K+ P+ V+ + +G K ++Y  
Sbjct: 122 ILKLRPVSYSFSDKPTREASLLRKGGDEREIGLLAQEVEKVLPNVVLTDAEGKKLINYTA 181

Query: 134 LFNIGQIQTKQKKNTAQ 150
           L  +     K  +   +
Sbjct: 182 LIPVMIDAIKSLQTEIE 198


>gi|307066694|ref|YP_003875660.1| PblB, putative [Streptococcus pneumoniae AP200]
 gi|306408231|gb|ADM83658.1| PblB, putative [Streptococcus phage PhiSpn_200]
          Length = 3035

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 2878 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2937

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2938 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 2997

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2998 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 3028


>gi|321156928|emb|CBW38917.1| PblB-type protein [Streptococcus phage V22]
          Length = 1468

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1311 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1370

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1371 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 1430

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1431 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1461


>gi|67484688|ref|XP_657564.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56474833|gb|EAL52189.1| hypothetical protein EHI_027790 [Entamoeba histolytica HM-1:IMSS]
          Length = 632

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 36/88 (40%), Gaps = 8/88 (9%)

Query: 69  QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
                 SD R+K ++         +  L    +    K  + +G IAQE+ ++ P+ V E
Sbjct: 218 NGFLQRSDARVKEHIEPLKGCLDKILKLTGKSFNYTGKEEKNLGFIAQEVQEVCPELVHE 277

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQKKNTA 149
           +  G  SVD   +  I     K+  N A
Sbjct: 278 DEFG-LSVDVIGIIPILVEALKEINNAA 304


>gi|149925860|ref|ZP_01914124.1| Putative membrane-anchored cell surface protein, haemagluttinin
            [Limnobacter sp. MED105]
 gi|149825977|gb|EDM85185.1| Putative membrane-anchored cell surface protein, haemagluttinin
            [Limnobacter sp. MED105]
          Length = 2613

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 35/142 (24%), Positives = 51/142 (35%), Gaps = 11/142 (7%)

Query: 20   VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRM 79
            +           P A     G            R  G  +   +  M      + SDRR+
Sbjct: 2220 IAIGDNVQTFGEPTADEFQVGRLNPDNSYNPVFRVAGNGDVIASGYMQATAFNVSSDRRL 2279

Query: 80   KCNVKPVA-----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
            K N++                Y Y YL++P   +RIGVIAQEI  + P+ V     G+ S
Sbjct: 2280 KTNIQVQDTGSVLSRLEQLQTYSYEYLANPNLGRRIGVIAQEIQNLFPEAVATRADGMMS 2339

Query: 129  VDYGRLFNIGQIQTKQKKNTAQ 150
            VDY  L  +  +   Q     +
Sbjct: 2340 VDYSALGAMAAMGVGQLSKQVK 2361


>gi|225857876|ref|YP_002739386.1| PblB [Streptococcus pneumoniae 70585]
 gi|225722145|gb|ACO17999.1| PblB [Streptococcus pneumoniae 70585]
          Length = 2970

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 46/152 (30%), Gaps = 15/152 (9%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYA-GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
               +        +  + +P+       G    +      +       +++ V  G     
Sbjct: 2812 FSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYW 2871

Query: 73   L--VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV- 120
            +   SDRR+K N+          +  L    +          IG+IAQE   I P  V  
Sbjct: 2872 MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSR 2931

Query: 121  --ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              EN  G   +DY  L        ++     +
Sbjct: 2932 DPENPDGYLHIDYTALVPYLIKAIQELNQKIE 2963


>gi|321156986|emb|CBW38974.1| PblB-type protein [Streptococcus phage 040922]
          Length = 2102

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1945 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYWM 2004

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2005 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 2064

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2065 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2095


>gi|67474538|ref|XP_653018.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56469935|gb|EAL47632.1| hypothetical protein EHI_178450 [Entamoeba histolytica HM-1:IMSS]
          Length = 626

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 53/141 (37%), Gaps = 13/141 (9%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
            ++ Q   +P+  ISL+        +     +    NQ  +R     E +          
Sbjct: 206 ANICQTTQIPQ-QISLSPIAYQLLTNNEEFIRVYMINQNIKRLHVAGEVF-----AENGF 259

Query: 72  PLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
              SDRR K ++K +++       +    Y     +  R G IAQE+ ++ P+ V E+  
Sbjct: 260 LQRSDRRSKKDIKKISDALNTILMITGKSYKYLNDDKTRFGFIAQELKEVIPEAVREDED 319

Query: 125 GIKSVDYGRLFNIGQIQTKQK 145
           G  S+D   L        KQ 
Sbjct: 320 GSLSIDPLALLPFIVESLKQL 340


>gi|307128260|ref|YP_003880291.1| PblB [Streptococcus pneumoniae 670-6B]
 gi|306485322|gb|ADM92191.1| PblB [Streptococcus pneumoniae 670-6B]
          Length = 2426

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 46/152 (30%), Gaps = 15/152 (9%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYA-GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
               +        +  + +P+       G    +      +       +++ V  G     
Sbjct: 2268 FSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYW 2327

Query: 73   L--VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV- 120
            +   SDRR+K N+          +  L    +          IG+IAQE   I P  V  
Sbjct: 2328 MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSR 2387

Query: 121  --ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              EN  G   +DY  L        ++     +
Sbjct: 2388 DPENPDGYLHIDYTALVPYLIKAIQELNQKIE 2419


>gi|321157044|emb|CBW39031.1| PblB-type protein [Streptococcus phage 34117]
          Length = 1633

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 46/152 (30%), Gaps = 15/152 (9%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYA-GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
               +        +  + +P+       G    +      +       +++ V  G     
Sbjct: 1475 FSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYW 1534

Query: 73   L--VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV- 120
            +   SDRR+K N+          +  L    +          IG+IAQE   I P  V  
Sbjct: 1535 MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSR 1594

Query: 121  --ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              EN  G   +DY  L        ++     +
Sbjct: 1595 DPENPDGYLHIDYTALVPYLIKAIQELNQKIE 1626


>gi|301799204|emb|CBW31717.1| pblB [Streptococcus pneumoniae OXC141]
          Length = 2101

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1944 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2003

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2004 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 2063

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2064 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2094


>gi|321157103|emb|CBW39089.1| PblB-type protein [Streptococcus phage 23782]
          Length = 1707

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1550 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1609

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1610 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 1669

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1670 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1700


>gi|225855356|ref|YP_002736868.1| PblB [Streptococcus pneumoniae JJA]
 gi|225722631|gb|ACO18484.1| PblB [Streptococcus pneumoniae JJA]
          Length = 2108

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1951 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2010

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2011 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 2070

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2071 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2101


>gi|168490166|ref|ZP_02714365.1| PblB [Streptococcus pneumoniae SP195]
 gi|183571459|gb|EDT91987.1| PblB [Streptococcus pneumoniae SP195]
          Length = 3023

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ +  G     +
Sbjct: 2866 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQIGSGSVKYWM 2925

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2926 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 2985

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2986 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 3016


>gi|321157149|emb|CBW39134.1| PblB-type protein [Streptococcus phage 11865]
          Length = 1421

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1264 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1323

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1324 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 1383

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1384 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1414


>gi|332072362|gb|EGI82845.1| pblB [Streptococcus pneumoniae GA17570]
          Length = 2147

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1990 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2049

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2050 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIESKKHEEIGLIAQEAETIVPRIVSRD 2109

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2110 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2140


>gi|303261114|ref|ZP_07347063.1| PblB [Streptococcus pneumoniae SP14-BS292]
 gi|303263442|ref|ZP_07349365.1| PblB [Streptococcus pneumoniae BS397]
 gi|303267835|ref|ZP_07353637.1| PblB [Streptococcus pneumoniae BS458]
 gi|302637951|gb|EFL68437.1| PblB [Streptococcus pneumoniae SP14-BS292]
 gi|302642531|gb|EFL72876.1| PblB [Streptococcus pneumoniae BS458]
 gi|302647215|gb|EFL77439.1| PblB [Streptococcus pneumoniae BS397]
          Length = 2105

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1948 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2007

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2008 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 2067

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2068 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2098


>gi|168494815|ref|ZP_02718958.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|183575310|gb|EDT95838.1| PblB [Streptococcus pneumoniae CDC3059-06]
          Length = 2676

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 2519 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2578

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2579 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 2638

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2639 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2669


>gi|172079550|ref|ZP_02708651.2| PblB [Streptococcus pneumoniae CDC1873-00]
 gi|172043007|gb|EDT51053.1| PblB [Streptococcus pneumoniae CDC1873-00]
          Length = 2654

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 2497 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYWM 2556

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2557 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 2616

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2617 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2647


>gi|183603147|ref|ZP_02712966.2| PblB [Streptococcus pneumoniae SP195]
 gi|183572670|gb|EDT93198.1| PblB [Streptococcus pneumoniae SP195]
          Length = 2135

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1978 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2037

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2038 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIESKKHEEIGLIAQEAETIVPRIVSRD 2097

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2098 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2128


>gi|321157197|emb|CBW39181.1| PblB-type protein [Streptococcus phage 8140]
          Length = 1179

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1022 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1081

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1082 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 1141

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1142 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1172


>gi|307126242|ref|YP_003878273.1| PblB [Streptococcus pneumoniae 670-6B]
 gi|306483304|gb|ADM90173.1| PblB [Streptococcus pneumoniae 670-6B]
          Length = 2699

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 2542 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 2601

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 2602 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 2661

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 2662 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 2692


>gi|150009626|ref|YP_001304369.1| hypothetical protein BDI_3040 [Parabacteroides distasonis ATCC
           8503]
 gi|298374024|ref|ZP_06983982.1| YapH protein [Bacteroides sp. 3_1_19]
 gi|301307620|ref|ZP_07213577.1| putative YapH protein [Bacteroides sp. 20_3]
 gi|149938050|gb|ABR44747.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
 gi|298268392|gb|EFI10047.1| YapH protein [Bacteroides sp. 3_1_19]
 gi|300834294|gb|EFK64907.1| putative YapH protein [Bacteroides sp. 20_3]
          Length = 292

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 37/97 (38%), Gaps = 17/97 (17%)

Query: 71  APLVSDRRMKCNVKP-------VANLYQYRYLSDPKNV----------QRIGVIAQEISK 113
               SD R+K N+ P       +  L    Y    +            +  G +AQE+++
Sbjct: 81  VYQSSDARLKTNITPLNSGLGTILGLKPVSYNWKSETSQLRSAEAVPSKAFGFLAQEVAE 140

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           + P+ V  ++ G   VDY  +  +     K+   T Q
Sbjct: 141 VMPEIVTLSSTGDSLVDYTAVIPVLVQAVKELDATIQ 177


>gi|332201943|gb|EGJ16012.1| phage minor structural , N-terminal region domain protein
            [Streptococcus pneumoniae GA41317]
          Length = 1924

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1767 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1826

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1827 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 1886

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1887 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1917


>gi|29347275|ref|NP_810778.1| putative fiber protein [Bacteroides thetaiotaomicron VPI-5482]
 gi|253571396|ref|ZP_04848803.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298386931|ref|ZP_06996486.1| fiber protein [Bacteroides sp. 1_1_14]
 gi|29339174|gb|AAO76972.1| putative fiber protein [Bacteroides thetaiotaomicron VPI-5482]
 gi|251839349|gb|EES67433.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|298260605|gb|EFI03474.1| fiber protein [Bacteroides sp. 1_1_14]
          Length = 203

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 43/125 (34%), Gaps = 22/125 (17%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSD 97
            + +Q+         +              SD R K N+ P+         L    Y   
Sbjct: 76  SHYDQVVFYNTASGVYNSIQVKN---VYNYSDARAKININPLGYGLNVLSKLNAVSYDFK 132

Query: 98  P------------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
                         + + IG++AQE+ K+ P+ V+ +  G K ++Y  +  I     K+ 
Sbjct: 133 DKNEPAAAAFRVGGDGKEIGLLAQEVEKVLPNIVLTDPDGNKLINYTAIIPIMIQSIKEL 192

Query: 146 KNTAQ 150
           K   +
Sbjct: 193 KAEVE 197


>gi|303288387|ref|XP_003063482.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226455314|gb|EEH52618.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 470

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 48/156 (30%), Gaps = 22/156 (14%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
            + +   T  +   ++              + N     L        +    + +   + 
Sbjct: 286 ATTITGATSAQGDFTVKASDGSEKFKITAASGNTVVQGLLSVAGAHADTSKKLYVNGDIY 345

Query: 72  PL-----VSDRRMKCNVKPVA---------NLYQYRYLSDPK--------NVQRIGVIAQ 109
                   SD R K +V+ +          ++    +  D +           +IG IAQ
Sbjct: 346 ATGSTTSASDERFKRDVRALDETLDALREEDVRPVTFNFDAEAHPTKVFPEGPQIGFIAQ 405

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
           E+ ++ P+ V     G KSV Y R+        K+ 
Sbjct: 406 ELERVLPNLVHTGADGFKSVAYDRVSVYALAGVKEL 441


>gi|149004162|ref|ZP_01828959.1| hypothetical protein CGSSp14BS69_05677 [Streptococcus pneumoniae
           SP14-BS69]
 gi|147757824|gb|EDK64835.1| hypothetical protein CGSSp14BS69_05677 [Streptococcus pneumoniae
           SP14-BS69]
          Length = 602

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
            N +      +          +    G    +      +       +++ V  G     +
Sbjct: 445 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 504

Query: 74  --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
              SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 505 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 564

Query: 121 -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            EN  G   +DY  L        ++     +
Sbjct: 565 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 595


>gi|168494864|ref|ZP_02719007.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|168495066|ref|ZP_02719209.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|183575070|gb|EDT95598.1| PblB [Streptococcus pneumoniae CDC3059-06]
 gi|183575230|gb|EDT95758.1| PblB [Streptococcus pneumoniae CDC3059-06]
          Length = 1349

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1192 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1251

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1252 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 1311

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1312 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1342


>gi|149011808|ref|ZP_01833004.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP19-BS75]
 gi|147764239|gb|EDK71171.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP19-BS75]
          Length = 1352

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1195 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1254

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1255 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPKIVSRD 1314

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1315 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1345


>gi|167386204|ref|XP_001737662.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165899432|gb|EDR26021.1| hypothetical protein EDI_013910 [Entamoeba dispar SAW760]
          Length = 619

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/140 (23%), Positives = 53/140 (37%), Gaps = 13/140 (9%)

Query: 13  SLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
           ++ Q   +P+  ISLN        +     +    NQ  +R     E +           
Sbjct: 207 NINQTTQIPQ-QISLNPIAYQLLTNNEEFIRVYMINQNIKRLHVAGEVF-----AENGFL 260

Query: 73  LVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
             SDRR K +VK +++       +    Y     +  R G IAQE+ ++ P+ V E+  G
Sbjct: 261 QRSDRRSKKDVKKISDALNTILMVTGKSYKYLNDDKTRFGFIAQELKEVIPEAVREDEDG 320

Query: 126 IKSVDYGRLFNIGQIQTKQK 145
             S+D   L        KQ 
Sbjct: 321 SLSIDPLALLPFIVESLKQL 340


>gi|67472891|ref|XP_652233.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56469055|gb|EAL46847.1| hypothetical protein EHI_149030 [Entamoeba histolytica HM-1:IMSS]
          Length = 581

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 69  QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
                 SD R+K ++         + NL    +    K+ +++G IAQE+ ++ P+ V E
Sbjct: 171 NGFLQRSDARVKEHIEPLKGCVDKILNLTGKSFKYIGKDEKKLGFIAQEVQEVCPELVHE 230

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQ 144
           +  G  SVD   +  I     K+
Sbjct: 231 DEFG-LSVDVIGIIPILVEALKE 252


>gi|260768854|ref|ZP_05877788.1| hypothetical protein VFA_001911 [Vibrio furnissii CIP 102972]
 gi|260616884|gb|EEX42069.1| hypothetical protein VFA_001911 [Vibrio furnissii CIP 102972]
          Length = 317

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 48/138 (34%), Gaps = 13/138 (9%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMG 67
           F+ + +L          +       ++ +   G    I    L+     ++     ++  
Sbjct: 182 FNALGALSGRGLQGSQGLGSFGGDTLSGM--TGTMSGIGTGALNSAAMQQQNKAGLLSAA 239

Query: 68  YQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKN----VQRIGVIAQEISKIRP 116
             L    SD R+K N+K           +Y + +    +         GVIA    ++ P
Sbjct: 240 GGLLAAFSDIRLKKNIKATGEYTDRGNEIYTWDWNEKAEKLGLVGSSRGVIADHAEQVTP 299

Query: 117 DTVVENNQGIKSVDYGRL 134
           D V  +  G K VDY R+
Sbjct: 300 DAVSTDKSGYKVVDYARV 317


>gi|291334968|gb|ADD94601.1| hypothetical protein [uncultured phage MedDCM-OCT-S08-C233]
          Length = 558

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 52/157 (33%), Gaps = 22/157 (14%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
            SL     V   P S      I     +G   ++  +    R + +  +  + +      
Sbjct: 393 TSLTNATQVVFHPGSSEYGIRINSTGTSGTQYHLSFD----RGQTQAGYITSNSATTIAV 448

Query: 72  PLVSDRRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
              SD R+K N++             + Q+ +  +    +  G +AQE+  I P+ V   
Sbjct: 449 NNSSDERLKENIENSGSALQDIKDLKVRQFDWKDNIDTHRDFGFVAQELHSIIPEAVSVG 508

Query: 123 NQGI---------KSVDYGRLFNIGQIQTKQKKNTAQ 150
           +  +           VDY  +        ++++   +
Sbjct: 509 SDELDDNGKPKQSWGVDYSHIVPRLVKAVQEQQTRIE 545


>gi|148986194|ref|ZP_01819146.1| phage-related protein; possible prophage LambdaBa01, minor structural
            protein [Streptococcus pneumoniae SP3-BS71]
 gi|147921808|gb|EDK72936.1| phage-related protein; possible prophage LambdaBa01, minor structural
            protein [Streptococcus pneumoniae SP3-BS71]
          Length = 1203

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1046 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1105

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1106 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 1165

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1166 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1196


>gi|303259359|ref|ZP_07345336.1| PblB [Streptococcus pneumoniae SP-BS293]
 gi|303265734|ref|ZP_07351632.1| PblB [Streptococcus pneumoniae BS457]
 gi|302639293|gb|EFL69751.1| PblB [Streptococcus pneumoniae SP-BS293]
 gi|302644642|gb|EFL74891.1| PblB [Streptococcus pneumoniae BS457]
          Length = 1530

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1373 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1432

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1433 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 1492

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1493 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1523


>gi|303255532|ref|ZP_07341590.1| hypothetical protein CGSSpBS455_08580 [Streptococcus pneumoniae
           BS455]
 gi|302597510|gb|EFL64598.1| hypothetical protein CGSSpBS455_08580 [Streptococcus pneumoniae
           BS455]
          Length = 965

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
            N +      +          +    G    +      +       +++ V  G     +
Sbjct: 808 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 867

Query: 74  --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
              SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 868 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 927

Query: 121 -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            EN  G   +DY  L        ++     +
Sbjct: 928 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 958


>gi|148996415|ref|ZP_01824133.1| phage infection protein [Streptococcus pneumoniae SP11-BS70]
 gi|147756990|gb|EDK64029.1| phage infection protein [Streptococcus pneumoniae SP11-BS70]
          Length = 1034

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 877  SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 936

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 937  EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 996

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 997  PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1027


>gi|329917056|ref|ZP_08276427.1| Putative membrane-anchored cell surface protein [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327544636|gb|EGF30101.1| Putative membrane-anchored cell surface protein [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 227

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 85  PVANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFN 136
            +  L    Y  D         +  +++G IAQ+I +  P+ V  + +G KSV Y +L  
Sbjct: 7   TIDALQGVHYEFDRAAFPKKGFEAGRQLGFIAQQIEQFVPEVVRTDAEGYKSVQYSQLVP 66

Query: 137 IGQIQTKQKKNTAQ 150
           +     K ++   Q
Sbjct: 67  LLAEGIKAQQLVLQ 80


>gi|332205033|gb|EGJ19096.1| pblB [Streptococcus pneumoniae GA47368]
          Length = 1137

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 46/152 (30%), Gaps = 15/152 (9%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP- 72
               +        +  + +P+        ++++  +  + +       +        L   
Sbjct: 979  FSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYW 1038

Query: 73   --LVSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV- 120
                SDRR+K N+          +  L    +          IG+IAQE   I P  V  
Sbjct: 1039 MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSR 1098

Query: 121  --ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              EN  G   +DY  L        ++     +
Sbjct: 1099 DPENPDGYLHIDYTALVPYLIKAIQELNQKIE 1130


>gi|255013093|ref|ZP_05285219.1| hypothetical protein B2_04253 [Bacteroides sp. 2_1_7]
          Length = 260

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 37/97 (38%), Gaps = 17/97 (17%)

Query: 71  APLVSDRRMKCNVKP-------VANLYQYRYLSDPKNV----------QRIGVIAQEISK 113
               SD R+K N+ P       +  L    Y    +            +  G +AQE+++
Sbjct: 49  VYQSSDARLKTNITPLNSGLGTILGLKPVSYNWKSETSQLRSAEAVPSKAFGFLAQEVAE 108

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           + P+ V  ++ G   VDY  +  +     K+   T Q
Sbjct: 109 VMPEIVTLSSTGDSLVDYTAVIPVLVQAVKELDATIQ 145


>gi|148995279|ref|ZP_01824069.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP9-BS68]
 gi|147926790|gb|EDK77848.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP9-BS68]
          Length = 1602

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
             N +      +          +    G    +      +       +++ V  G     +
Sbjct: 1445 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 1504

Query: 74   --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
               SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 1505 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIESKKHEEIGLIAQEAETIVPRIVSRD 1564

Query: 121  -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             EN  G   +DY  L        ++     +
Sbjct: 1565 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 1595


>gi|167378652|ref|XP_001733268.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165903382|gb|EDR28952.1| hypothetical protein EDI_040590 [Entamoeba dispar SAW760]
          Length = 552

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 69  QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
                 SD R+K ++         + NL    +    K+ +++G IAQE+ ++ P+ V E
Sbjct: 171 NGFLQRSDARVKEHIEPLKGCVDKILNLTGKSFKYIGKDDKKLGFIAQEVQEVCPELVHE 230

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQ 144
           +  G  SVD   +  I     K+
Sbjct: 231 DEFG-LSVDVIGIIPILVEALKE 252


>gi|167396330|ref|XP_001742013.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165893164|gb|EDR21505.1| hypothetical protein EDI_049010 [Entamoeba dispar SAW760]
          Length = 411

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 32/168 (19%), Positives = 53/168 (31%), Gaps = 26/168 (15%)

Query: 1   MDQKQQAFHEILSLMQNVT--VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK 58
           + +    F  +     N         IS            A IA      Q     +   
Sbjct: 179 ISESNYPFAFLSEYQFNSQFITNNYHISPTEQPIQQFQPTATIAIEETNQQNPNIIQDNS 238

Query: 59  EFYDAVNMGY--------------QLAPLVSDRRMKCNVKPVANL---------YQYRYL 95
           +F     +                    + SD R K +++ + N           +Y Y 
Sbjct: 239 DFIKIEQITTQLKRLHVFGEIFAENGYLVRSDARSKTDIQTIENALNSVTSLVGKKYAYK 298

Query: 96  SDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTK 143
           ++P N  + G IAQE+ ++ PD V ++  G  SVDY  +        K
Sbjct: 299 NEP-NKIKYGFIAQEVQEVIPDLVQKDESGNLSVDYLGVIPYIVEALK 345


>gi|167387265|ref|XP_001738089.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165898835|gb|EDR25599.1| hypothetical protein EDI_172560 [Entamoeba dispar SAW760]
          Length = 567

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 52/150 (34%), Gaps = 14/150 (9%)

Query: 6   QAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAG--IAQNIYQNQLSERKEGKKEFYDA 63
           Q  ++I               + NP     I+  G    +  Y NQ   R     E +  
Sbjct: 158 QIPNQIQDQYTQDDKVSGNRIIINPITYELINSCGEDFIRIYYINQNIRRLHVFGEIF-- 215

Query: 64  VNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRP 116
                      SD+R K ++K ++N       L    Y       +R G IAQE+ +I P
Sbjct: 216 ---AENGFLQRSDQRYKKDIKKISNALEKIMLLTGRSYKYLNDKQKRFGFIAQELKEIIP 272

Query: 117 DTVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
           + V E+  G  S++   L        K+  
Sbjct: 273 EAVKEDEDGTLSIEPLALLPFIIESLKELN 302


>gi|149021849|ref|ZP_01835856.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
           SP23-BS72]
 gi|147930085|gb|EDK81072.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
           SP23-BS72]
          Length = 999

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 44/151 (29%), Gaps = 16/151 (10%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
            N +      +          +    G    +      +       +++ V  G     +
Sbjct: 842 SNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSVKYWM 901

Query: 74  --VSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV-- 120
              SDRR+K N+          +  L    +          IG+IAQE   I P  V   
Sbjct: 902 EQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSRD 961

Query: 121 -ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            EN  G   +DY  L        ++     +
Sbjct: 962 PENPDGYLHIDYTALVPYLIKAIQELNQKIE 992


>gi|148990394|ref|ZP_01821566.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP6-BS73]
 gi|147924349|gb|EDK75441.1| prophage LambdaSa2, PblB, putative [Streptococcus pneumoniae
            SP6-BS73]
          Length = 1053

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 46/152 (30%), Gaps = 15/152 (9%)

Query: 14   LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP- 72
               +        +  + +P+        ++++  +  + +       +        L   
Sbjct: 895  FSNSSRANFYGNTTFSRSPVFSNGIELGSKDVLGDGWNPKGGRNAVVWWNQVGSGSLKYW 954

Query: 73   --LVSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR-IGVIAQEISKIRPDTVV- 120
                SDRR+K N+          +  L    +          IG+IAQE   I P  V  
Sbjct: 955  MEQKSDRRLKENITDTAVKALDKINRLRMVAFDFIENKKHEEIGLIAQEAETIVPRIVSR 1014

Query: 121  --ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              EN  G   +DY  L        ++     +
Sbjct: 1015 DPENPDGYLHIDYTALVPYLIKAIQELNQKIE 1046


>gi|67476753|ref|XP_653929.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56470931|gb|EAL48542.1| hypothetical protein EHI_105190 [Entamoeba histolytica HM-1:IMSS]
          Length = 487

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 7/86 (8%)

Query: 69  QLAPLVSDRRMKCNVKPVAN-----LYQY--RYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               + SD+R K N++ + N     +  +   +  +     R G IAQ++ ++ P+ V E
Sbjct: 84  NGFVVRSDKRKKHNIQKIKNALNKIVNIFCCTFKYNNDETIRSGFIAQQLQQVVPELVHE 143

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQKKN 147
              G  S+D   L  +     K  KN
Sbjct: 144 EIDGTLSIDSLALIPVIIESLKTLKN 169


>gi|29349237|ref|NP_812740.1| hypothetical protein BT_3829 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29341145|gb|AAO78934.1| conserved hypothetical protein [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 203

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 42/125 (33%), Gaps = 22/125 (17%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSD 97
            + +Q+         +              SD R K N+ P+         L    Y   
Sbjct: 76  SHYDQVVFYNTASGVYNSIQVKN---VYNYSDARAKININPLGYGLNVLSKLNAVSYDFK 132

Query: 98  P------------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
                         + + IG++AQE+ K+ P+ V+ +  G K + Y  +  I     K+ 
Sbjct: 133 DKNEPAAAAFRVGGDGKEIGLLAQEVEKVLPNIVLTDPDGNKLISYTAIIPIMIQSIKEL 192

Query: 146 KNTAQ 150
           K   +
Sbjct: 193 KAEVE 197


>gi|269838889|ref|YP_001950049.2| hypothetical protein RSL1_gp174 [Ralstonia phage RSL1]
 gi|239793685|dbj|BAG41619.2| hypothetical protein [Ralstonia phage RSL1]
          Length = 1224

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/161 (13%), Positives = 45/161 (27%), Gaps = 17/161 (10%)

Query: 5    QQAFHEILSLMQNVTVPKLPISLNNPTPIAPI------DYAGIAQNIYQNQLSERKEGKK 58
                +  +     +++     S+      +        + AG       N          
Sbjct: 1045 NGTIN--VGTDSAISMNGASNSILQLKTTSYNRLMYLENGAGNIIFAVSNGSFGATSTLM 1102

Query: 59   EFYDAVNMGYQLAPLVSDRRMKCNVKPVANLY-------QYRYLSDPKNVQRIGVIAQEI 111
                   +        SDR  K +++P+              +       + +G IAQ+ 
Sbjct: 1103 TISGTGMVSATDFTATSDRNAKTDIQPLVGARALVLGMQGMSFTMKASGKKSVGFIAQDF 1162

Query: 112  S--KIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
               +   D V  N  G  S+ YG +  +     K++    Q
Sbjct: 1163 QPHQYLKDLVHTNEDGTLSLSYGPVSAVLVEAFKEQDEELQ 1203


>gi|167382030|ref|XP_001735950.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165901856|gb|EDR27843.1| hypothetical protein EDI_154750 [Entamoeba dispar SAW760]
          Length = 603

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 45/142 (31%), Gaps = 11/142 (7%)

Query: 10  EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ 69
           EI       T   L  S                  + + +    K  +      +     
Sbjct: 142 EINKTDSETTENILNNSQEYQIIEEKNKEEYQINELLKIKRIRNKVQQLYMLGEIFSNEG 201

Query: 70  LAPLVSDRRMKCNVKPV-------ANLYQYRYLSD---PKNVQRIGVIAQEISKIRPDTV 119
              + SD+R K  ++ +        +LY   +           R G IAQE+ KI P+ V
Sbjct: 202 -FLVRSDKRNKKEIEKINNALYGIKHLYGREFKYLTDLENKTPRYGFIAQEVKKIYPELV 260

Query: 120 VENNQGIKSVDYGRLFNIGQIQ 141
             + +G  +VDY  +  I    
Sbjct: 261 EIDEEGGLTVDYLGIIPIMVEA 282


>gi|294661657|ref|YP_003580110.1| L-shaped tail fiber protein [Klebsiella phage KP15]
 gi|292660818|gb|ADE35066.1| L-shaped tail fiber protein [Klebsiella phage KP15]
          Length = 1328

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/143 (18%), Positives = 52/143 (36%), Gaps = 13/143 (9%)

Query: 21   PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
                +SL     +     A +  N Y    S       +F    N  +    + SDRR K
Sbjct: 1179 NGAYVSLYFQEYVGSYHQAILNVNGYGQDNSFYFRAGGDFICTRNGSFDNVEIRSDRRAK 1238

Query: 81   CNV-------KPVANLYQYRY---LSDPKNVQRIGVIAQEISKIRPDTVVEN---NQGIK 127
             ++       + V  L    Y    +     +  G+IAQE+ ++ P+ V ++   + G+ 
Sbjct: 1239 SDIKVIENALEKVEKLTGNTYELHNTSGGTTRSAGLIAQEVQEVLPEAVTQDIEADGGLL 1298

Query: 128  SVDYGRLFNIGQIQTKQKKNTAQ 150
             ++Y  +  +     K+     +
Sbjct: 1299 RLNYNSVIALLVESVKELSAEVK 1321


>gi|167379170|ref|XP_001735022.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165903154|gb|EDR28804.1| hypothetical protein EDI_130810 [Entamoeba dispar SAW760]
          Length = 487

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 7/86 (8%)

Query: 69  QLAPLVSDRRMKCNVKPVAN-----LYQY--RYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               + SD+R K N++ + N     +  +   +  +     R G IAQ++ ++ P+ V E
Sbjct: 84  NGFVVRSDQRKKHNIQKIKNALNKIINIFCCTFKYNNDESIRSGFIAQQLQQVVPELVHE 143

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQKKN 147
              G  S+D   L  +     K  KN
Sbjct: 144 EIDGTLSIDSLALIPVIIESLKTLKN 169


>gi|326489541|dbj|BAK01751.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 374

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 36/96 (37%), Gaps = 8/96 (8%)

Query: 57  KKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQ 109
                    +  Q    +SDR++K N+         V+ L    +         +G IA 
Sbjct: 241 GNLDVSNGFVVSQQFVQLSDRKLKENIVDLSNALDIVSKLKGKTFTWKNNQQHCLGFIAN 300

Query: 110 EISKIRPDTVVENN-QGIKSVDYGRLFNIGQIQTKQ 144
           E+ ++ P  VV +   G K++ Y  LF +      +
Sbjct: 301 EVEEVLPSIVVSDPSSGCKAISYVELFPVLVNSINE 336


>gi|42524641|ref|NP_970021.1| putative cell wall surface anchor family protein [Bdellovibrio
            bacteriovorus HD100]
 gi|39576851|emb|CAE78080.1| putative cell wall surface anchor family protein [Bdellovibrio
            bacteriovorus HD100]
          Length = 1507

 Score = 63.6 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 42/149 (28%), Gaps = 22/149 (14%)

Query: 19   TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDA------------VNM 66
                   S    T       +G       N++   +                        
Sbjct: 1301 QFYARTASPTTRTGYFGTPASGSTNMNVANEMEGGQIDFLTKSGGAVSAKMTLSAVGNLT 1360

Query: 67   GYQLAPLVSDRRMKCNVK-------PVANLYQYRYLSDP---KNVQRIGVIAQEISKIRP 116
                    SD R+K  +         +  L    Y           ++G IAQE+ K+ P
Sbjct: 1361 TAGTVNGASDIRLKKEIHVLDGSLDKILQLKPSSYHWKDPNADPRLQMGFIAQELEKVYP 1420

Query: 117  DTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
            + V EN +GIK+V Y  +        ++ 
Sbjct: 1421 NVVEENKKGIKAVSYINMIAPITSAVQEL 1449


>gi|254444266|ref|ZP_05057742.1| hypothetical protein VDG1235_2505 [Verrucomicrobiae bacterium
           DG1235]
 gi|198258574|gb|EDY82882.1| hypothetical protein VDG1235_2505 [Verrucomicrobiae bacterium
           DG1235]
          Length = 454

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 10/132 (7%)

Query: 28  NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA 87
           +  +  + +   G  Q                   +  +   L    SDRR+K +++P+ 
Sbjct: 299 SPISAFSAMAEHGRGQVYNYLGYDFEGNANFTVNTSGVVVGLLFSQSSDRRLKQDIEPIN 358

Query: 88  NL---------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIG 138
           ++           Y + + P+   + G IAQ++ ++ P+ V E+ +   S++Y  L  + 
Sbjct: 359 DVLPRLAQLEAKSYHFKASPEVGLQYGFIAQDVQEVFPEVVGESGE-HLSLNYTALGVVA 417

Query: 139 QIQTKQKKNTAQ 150
                +      
Sbjct: 418 IEGINELNEKVD 429


>gi|90415840|ref|ZP_01223773.1| putative outer membrane protein [marine gamma proteobacterium
            HTCC2207]
 gi|90332214|gb|EAS47411.1| putative outer membrane protein [marine gamma proteobacterium
            HTCC2207]
          Length = 1157

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 46/155 (29%), Gaps = 17/155 (10%)

Query: 13   SLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ--- 69
            +L  N T  +           +       A        +              +      
Sbjct: 984  ALYTNTTGSQNTAIGYGADVASGDLTNATAIGNGAIVTASNTIQLGNASVTNVVTSGRLL 1043

Query: 70   --LAPLVSDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
              +  + SDRR+K ++         +  L    Y     N++RIG IAQE+  I P+ V 
Sbjct: 1044 ADMYLIASDRRLKKDIVDTRYGLNTILELRPVDYKVKSNNLERIGFIAQELRPIVPEVVK 1103

Query: 121  E-----NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                         V Y  L  +     ++++   +
Sbjct: 1104 GIEGDLEKGETLRVAYTSLIPVLTKAIQEQQLLIE 1138


>gi|224002787|ref|XP_002291065.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220972841|gb|EED91172.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 2011

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 36/106 (33%), Gaps = 27/106 (25%)

Query: 67   GYQLAPLVSDRRMKCNVKPVAN---------LYQYRYLSD------------------PK 99
            G      VSD R K NV  + +         L    Y  D                    
Sbjct: 1892 GSGPYVDVSDGRYKRNVVKIDSKDALGKILLLEGVSYELDLSEVGKHERLGRGGVLTSDN 1951

Query: 100  NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
              +++G IAQ++ K+ P+ V  +    K + Y RL  +     KQ 
Sbjct: 1952 QERQLGFIAQDVEKVFPELVYNDASDFKGLQYARLAPVLVEGLKQL 1997


>gi|67476787|ref|XP_653943.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56470945|gb|EAL48556.1| hypothetical protein EHI_105320 [Entamoeba histolytica HM-1:IMSS]
          Length = 678

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 10/89 (11%)

Query: 69  QLAPLVSDRRMKCNVKPVANL---------YQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
               + SD R K +++ + N           +Y Y ++P N  + G IAQE+ +I PD V
Sbjct: 243 NGYLVRSDARSKTDIQTIENALNSVTSLVGKKYAYKNEP-NKIKYGFIAQEVQEIIPDLV 301

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQKKNT 148
            ++     SVDY  L        K   + 
Sbjct: 302 QKDETNNLSVDYLGLIPYIIEALKSIHDN 330


>gi|67477000|ref|XP_654021.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56471036|gb|EAL48635.1| hypothetical protein EHI_064510 [Entamoeba histolytica HM-1:IMSS]
          Length = 524

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 31/88 (35%), Gaps = 7/88 (7%)

Query: 69  QLAPLVSDRRMKCNVKPV----ANLYQYR---YLSDPKNVQRIGVIAQEISKIRPDTVVE 121
                 SD R K  + P+      L       Y  D  N +  G IAQE+ +  PD V E
Sbjct: 195 NGFFQRSDSRTKTKIAPIRNALERLLNVTGKMYTYDVANAETYGFIAQELKEHFPDLVHE 254

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQKKNTA 149
           +  G  S+D   L        K+     
Sbjct: 255 DESGYLSIDPISLIPFTVEAVKELDKEI 282


>gi|167394032|ref|XP_001740814.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165894905|gb|EDR22737.1| hypothetical protein EDI_336360 [Entamoeba dispar SAW760]
          Length = 524

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 31/88 (35%), Gaps = 7/88 (7%)

Query: 69  QLAPLVSDRRMKCNVKPV----ANLYQYR---YLSDPKNVQRIGVIAQEISKIRPDTVVE 121
                 SD R K  V P+      L       Y  D  + +  G IAQE+ +  PD V E
Sbjct: 195 NGFFQRSDSRTKTKVAPIRNALERLLNVTGKMYTYDVADAETYGFIAQELKEQFPDLVHE 254

Query: 122 NNQGIKSVDYGRLFNIGQIQTKQKKNTA 149
           +  G  S+D   L        K+     
Sbjct: 255 DESGYLSIDPISLIPFIVEAVKELDKEI 282


>gi|222033290|emb|CAP76030.1| hypothetical protein LF82_260 [Escherichia coli LF82]
 gi|284921274|emb|CBG34340.1| putative phage protein [Escherichia coli 042]
 gi|312946130|gb|ADR26957.1| hypothetical protein NRG857_07665 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|323962431|gb|EGB58014.1| hypothetical protein ERGG_01133 [Escherichia coli H489]
          Length = 346

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 46/157 (29%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q      +   L   T    +   G+    Y     +  +             
Sbjct: 161 STMTLNTQGTAYAGVTAQLWGNTSRPVVYEVGVDGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 281 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|299142230|ref|ZP_07035363.1| hypothetical protein HMPREF0665_01821 [Prevotella oris C735]
 gi|298576319|gb|EFI48192.1| hypothetical protein HMPREF0665_01821 [Prevotella oris C735]
          Length = 831

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 47/124 (37%), Gaps = 11/124 (8%)

Query: 38  YAGIAQNIYQNQLSERKEGKKEFYDAVNM-GYQLAPLVSDRRMKCNVKPVANLY------ 90
              +  N +QN L   ++    FY  V   G   A   SDRR K N+K V ++       
Sbjct: 687 QFNVYNNGWQNALILSRDKNATFYGNVLAQGGVTAYTTSDRRSKENIKAVDSMKIIRSLG 746

Query: 91  -QYRYLSDPKNVQRIGVIAQEI-SKIRPDTVVENNQGIKSVDY--GRLFNIGQIQTKQKK 146
             +++         IG IAQ +   +    V  ++ G   ++Y   RL  +      Q  
Sbjct: 747 GTWQFDYKDTGKHGIGFIAQSVRESMLKSMVYASDDGYLKLNYLDTRLIALALGAAVQVD 806

Query: 147 NTAQ 150
           +  +
Sbjct: 807 DKVE 810


>gi|26248990|ref|NP_755030.1| hypothetical protein c3148 [Escherichia coli CFT073]
 gi|26109397|gb|AAN81600.1|AE016765_2 Hypothetical protein c3148 [Escherichia coli CFT073]
          Length = 346

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 46/157 (29%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q      +   L   +    +   G+    Y     +  +             
Sbjct: 161 STMTLNTQGTAYAGVTAQLWGNSSRPVVYEVGVDGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 281 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|27380286|ref|NP_771815.1| hypothetical protein bll5175 [Bradyrhizobium japonicum USDA 110]
 gi|27353450|dbj|BAC50440.1| bll5175 [Bradyrhizobium japonicum USDA 110]
          Length = 552

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 75  SDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
           SD  +K +V  +  L      YR+  +  +   +GVIAQE+  +RPD V   + G   V 
Sbjct: 464 SDINLKHDVVLLGRLDNGLGYYRFAYNGSDKAYVGVIAQEVQTVRPDAVTRGSDGNLRVY 523

Query: 131 YGRL 134
           Y RL
Sbjct: 524 YERL 527


>gi|167376221|ref|XP_001733910.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904804|gb|EDR29951.1| hypothetical protein EDI_007940 [Entamoeba dispar SAW760]
          Length = 298

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 69  QLAPLVSDRRMKCNVKPVAN-LYQ--------YRYLSDPKNVQRIGVIAQEISKIRPDTV 119
               + SD R K +++ + N L          Y Y  D  N +  G IAQE+ KI P+ V
Sbjct: 225 NGFLVRSDARSKTDIEEIHNSLNGILSLVGVSYSYKKDCDNKKY-GFIAQEVQKIYPELV 283

Query: 120 VENNQGIKSVDY 131
            E++ G  +VDY
Sbjct: 284 KEDDTGKLTVDY 295


>gi|167396255|ref|XP_001741977.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165893173|gb|EDR21513.1| hypothetical protein EDI_289470 [Entamoeba dispar SAW760]
          Length = 561

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 47/137 (34%), Gaps = 7/137 (5%)

Query: 21  PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
            +   S N               N +    S  +  K+ +              SD+R K
Sbjct: 165 TQFGQSSNGIMVTPFTSQLLSLGNDFIRIYSISQNVKRLYVAGEIFAENGFLQRSDKRSK 224

Query: 81  CNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGR 133
            ++K +++       +    +    ++  R G IAQE+ ++  D V E+  G  S+D   
Sbjct: 225 KDIKRISHALDTICKITGKSFKYVNEDRTRFGFIAQELKEVITDAVKEDEDGRFSIDPLS 284

Query: 134 LFNIGQIQTKQKKNTAQ 150
           L        K+ +   +
Sbjct: 285 LLPFIVESLKELQIELK 301


>gi|313157451|gb|EFR56872.1| conserved hypothetical protein [Alistipes sp. HGB5]
          Length = 221

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 21/101 (20%)

Query: 71  APLVSDRRMKCNVKPVA-------NLYQYRYLSDP--------------KNVQRIGVIAQ 109
               SD   K N++ +         L    +                   N + +G IAQ
Sbjct: 108 VYTNSDAASKTNIQSLGSATATLTQLRPVSFEWADKAHYFKTSRRSTGVSNPKEMGFIAQ 167

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           EI ++ PD V  + +G + V+Y  L  +     ++     +
Sbjct: 168 EIEQVLPDIVAVDCEGHRVVNYSALIPLLTKSIQELNGQIE 208


>gi|291514530|emb|CBK63740.1| hypothetical protein AL1_12670 [Alistipes shahii WAL 8301]
          Length = 174

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 21/101 (20%)

Query: 71  APLVSDRRMKCNVKPVA-------NLYQYRYLSDP--------------KNVQRIGVIAQ 109
               SD   K N++ +         L    +                   N + +G IAQ
Sbjct: 61  VYTNSDAASKTNIQSLGSATATLTQLRPVSFEWADKAHYFKTSRRSTGVSNPKEMGFIAQ 120

Query: 110 EISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           EI ++ PD V  + +G + V+Y  L  +     ++     +
Sbjct: 121 EIEQVLPDIVAVDCEGHRVVNYSALIPLLTKSIQELNGQIE 161


>gi|331662824|ref|ZP_08363744.1| conserved hypothetical protein [Escherichia coli TA143]
 gi|331059991|gb|EGI31958.1| conserved hypothetical protein [Escherichia coli TA143]
          Length = 346

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 46/157 (29%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q      +   L   +    +   G+    Y     +  +             
Sbjct: 161 STMTLNTQGTAYAGVTAQLWGNSSRPVVYEVGVDGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 281 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|255073495|ref|XP_002500422.1| predicted protein [Micromonas sp. RCC299]
 gi|226515685|gb|ACO61680.1| predicted protein [Micromonas sp. RCC299]
          Length = 495

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 45/159 (28%), Gaps = 15/159 (9%)

Query: 7   AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
             +         +   L +       +A      +         S     K  +      
Sbjct: 287 TLNSATVTTTLHSGGDLTVGTGPKLTVAASSGDVVTAGKIAVAGSHGDATKALYVTGSVY 346

Query: 67  GYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPK--------NVQRIGVIAQEI 111
                   SD R K +V+ + +       L    +                + G +AQ++
Sbjct: 347 ATGAVTSASDSRFKRDVRSIHDPLAIVRSLEPVTFTFKRDAFPTRDFPVETQAGFLAQDL 406

Query: 112 SKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            ++ P  V E+++G K V Y RL        K    + +
Sbjct: 407 ERVLPHLVTEDDEGYKGVAYERLGVYAVAGVKALDESME 445


>gi|301307622|ref|ZP_07213579.1| conserved hypothetical protein [Bacteroides sp. 20_3]
 gi|300834296|gb|EFK64909.1| conserved hypothetical protein [Bacteroides sp. 20_3]
          Length = 393

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 98  PKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             + +RIG +AQ+I K+ P+ V  +  G+ S+DY     +     K+ + T Q
Sbjct: 226 EASRKRIGFLAQDIQKVLPELVQTDENGMMSIDYIGFIPLIVESIKEMQQTIQ 278


>gi|291335849|gb|ADD95446.1| hypothetical protein [uncultured phage MedDCM-OCT-S08-C239]
          Length = 488

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/155 (12%), Positives = 43/155 (27%), Gaps = 27/155 (17%)

Query: 22  KLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKC 81
               S +        D +     I   Q S      +    + +         SD R+K 
Sbjct: 330 GAGSSTDADGMWFNNDQSASGTFIRFWQTSGSYGANQIGSISHSANNTSYNTSSDYRLKE 389

Query: 82  NVKPVAN---------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG------- 125
           N   +++          Y++ ++S+P      G  A E +   P+ V             
Sbjct: 390 NAVAISDGITRLKTLKPYRFNFISEPSKTVD-GFFAHEAATTVPEAVTGTKDEVATIADT 448

Query: 126 ----------IKSVDYGRLFNIGQIQTKQKKNTAQ 150
                      + +D  +L  +     ++     +
Sbjct: 449 SIGVAVGDPVYQGIDQSKLVPLLVAAVQELTAKVE 483


>gi|301018760|ref|ZP_07183043.1| conserved hypothetical protein [Escherichia coli MS 69-1]
 gi|300399562|gb|EFJ83100.1| conserved hypothetical protein [Escherichia coli MS 69-1]
          Length = 328

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 46/157 (29%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q      +   L   +    +   G+    Y     +  +             
Sbjct: 161 STMTLNTQGTAYAGVTAQLWGNSSRPVVYEVGVDGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 281 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|301020425|ref|ZP_07184522.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|299881833|gb|EFI90044.1| conserved hypothetical protein [Escherichia coli MS 196-1]
          Length = 328

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 46/157 (29%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q      +   L   +    +   G+    Y     +  +             
Sbjct: 161 STMTLNTQGTAYAGVTAQLWGNSSRPVVYEVGVDGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 281 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|255013091|ref|ZP_05285217.1| hypothetical protein B2_04243 [Bacteroides sp. 2_1_7]
          Length = 345

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 98  PKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             + +RIG +AQ+I K+ P+ V  +  G+ S+DY     +     K+ + T Q
Sbjct: 178 EASRKRIGFLAQDIQKVLPELVQTDENGMMSIDYIGFIPLIVESIKEMQQTIQ 230


>gi|183232159|ref|XP_653936.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|169802174|gb|EAL48549.2| hypothetical protein EHI_105260 [Entamoeba histolytica HM-1:IMSS]
          Length = 675

 Score = 60.9 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 8/89 (8%)

Query: 69  QLAPLVSDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               + SD R KC+++P       ++ L   +Y        R+G +AQE+ ++ PD V  
Sbjct: 289 NGYFVRSDERTKCHIRPLSDCLESISQLVGKQYRYKNSPQLRLGFVAQEVKEVLPDLVHT 348

Query: 122 NN-QGIKSVDYGRLFNIGQIQTKQKKNTA 149
           +   G  SVD   +        KQ  +  
Sbjct: 349 DEITGTLSVDVLGVIPFLVESLKQLNSEI 377


>gi|298374027|ref|ZP_06983985.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
 gi|298268395|gb|EFI10050.1| conserved hypothetical protein [Bacteroides sp. 3_1_19]
          Length = 404

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 98  PKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             + +RIG +AQ+I K+ P+ V  +  G+ S+DY     +     K+ + T Q
Sbjct: 237 EASRKRIGFLAQDIQKVLPELVQTDENGMMSIDYIGFIPLIVESIKEMQQTIQ 289


>gi|200390047|ref|ZP_03216658.1| putative L-shaped tail fiber protein [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199602492|gb|EDZ01038.1| putative L-shaped tail fiber protein [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 837

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 48/157 (30%), Gaps = 25/157 (15%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
            T      +  NP     +   G  ++ +       ++  K+      +        SDR
Sbjct: 657 GTATPYYYTFGNPDGRRSVTEFGTVEDGWIFYGQVNRDLSKQLDVNGVVNASAFNQASDR 716

Query: 78  RMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV---------- 120
            +K N++ ++N       +  Y Y      +   GVIAQE+  + P+             
Sbjct: 717 DLKENIEVISNAIDRVRAIGGYTYTLKENGMPHAGVIAQEVRDVLPEASGSFTKYVDLPG 776

Query: 121 --------ENNQGIKSVDYGRLFNIGQIQTKQKKNTA 149
                      +   SVDY  +  +     K+     
Sbjct: 777 PTQDGTPLREEERFYSVDYAGITALLVQAFKEMDEKI 813


>gi|85059214|ref|YP_454916.1| hypothetical protein SG1235 [Sodalis glossinidius str. 'morsitans']
 gi|84779734|dbj|BAE74511.1| hypothetical protein [Sodalis glossinidius str. 'morsitans']
          Length = 313

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 40/106 (37%), Gaps = 19/106 (17%)

Query: 62  DAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKI 114
            +           SDRR+K +++ + N       L  Y Y+      ++ GV+A E+ K+
Sbjct: 189 GSAYAMQGHWQNNSDRRIKSDIEKIENGLEKVETLTGYTYVL--AEHRQAGVMADELEKV 246

Query: 115 RPDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P+ V  +             +KSV YG +  +     K      +
Sbjct: 247 LPEAVGNSGDYHESDGTVVKNVKSVAYGSITALLIEAIKDLSAKVK 292


>gi|109290197|ref|YP_656446.1| gp36 small distal tail fiber subunit [Aeromonas phage 25]
 gi|104345870|gb|ABF72770.1| gp36 small distal tail fiber subunit [Aeromonas phage 25]
          Length = 1305

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/114 (19%), Positives = 40/114 (35%), Gaps = 10/114 (8%)

Query: 42   AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL---------YQY 92
                + N  +              +      + SDRR+K N K + N            Y
Sbjct: 1182 GNGAWDNTNTWLVLNNSGAAFNGIVAAPDFNVTSDRRLKSNFKAIDNPLSKVEQLTGQIY 1241

Query: 93   RYLSDPKN-VQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
                     V  +G+IAQ + K++P +V E + G+ S+    +  +     K+ 
Sbjct: 1242 DKKLKDGGIVSEVGLIAQHVQKVQPMSVREGDDGMLSISPSGIIALLVEAVKEL 1295


>gi|86360402|ref|YP_472290.1| hypothetical protein RHE_PE00125 [Rhizobium etli CFN 42]
 gi|86284504|gb|ABC93563.1| hypothetical protein RHE_PE00125 [Rhizobium etli CFN 42]
          Length = 217

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 75  SDRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
           SDRR+K +++ +        +Y +RY+        +G +AQ++  IRPD + ++  G   
Sbjct: 111 SDRRLKTDIRRLGTSPAGIPIYAFRYIW--GGPLFVGTMAQDLLLIRPDVLSQDATGYYM 168

Query: 129 VDYGRL 134
           VDY RL
Sbjct: 169 VDYARL 174


>gi|317503032|ref|ZP_07961112.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
 gi|315665832|gb|EFV05419.1| conserved hypothetical protein [Prevotella salivae DSM 15606]
          Length = 306

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 47/155 (30%), Gaps = 13/155 (8%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLS---ERKEGKKEFYDAVN 65
           ++    + +        +      +   D           Q +    R        + + 
Sbjct: 133 NQRALFISSSNTVYFGCNDRPLYTLFEGDELQFNVYNKGWQNALVISRDRTAIFTGNVLA 192

Query: 66  MGYQLAPLVSDRRMKCNVKPVANLY-------QYRYLSDPKNVQRIGVIAQEIS-KIRPD 117
            G   A   SDRR+K N+K V ++         +++         IG IAQ +       
Sbjct: 193 QGGVTAYTTSDRRLKENIKQVDSMRIIRSLGGTWQFDYKDTGEHSIGFIAQSVKGSALGS 252

Query: 118 TVVENNQGIKSVDY--GRLFNIGQIQTKQKKNTAQ 150
            V  N  G   ++Y   RL  +      Q  +  +
Sbjct: 253 MVYTNADGYMKLNYLDTRLIALALGAAVQVDDKVE 287


>gi|150009628|ref|YP_001304371.1| hypothetical protein BDI_3042 [Parabacteroides distasonis ATCC
           8503]
 gi|149938052|gb|ABR44749.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
          Length = 393

 Score = 60.9 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 98  PKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             + +RIG +AQ+I K+ P+ V  +  G+ S+DY     +     K+ + T Q
Sbjct: 226 EASRKRIGFLAQDIQKVLPELVQTDENGMMSIDYIGFIPLIVESIKEMQQTIQ 278


>gi|15320624|ref|NP_203468.1| hypothetical protein Mx8p54 [Myxococcus phage Mx8]
 gi|15281734|gb|AAK94389.1|AF396866_54 p54 [Myxococcus phage Mx8]
          Length = 333

 Score = 60.9 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 53/136 (38%), Gaps = 8/136 (5%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           + Q+ Q   E  +L   +++P    +             G          +  +     F
Sbjct: 189 LRQRGQPMAEAQALQGFLSMPGFNNAGAYSPTDYLGAAMGQHNANMGQWQASNQANADVF 248

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDPKNVQRIGVIAQEISK 113
              +N+   L   +SD RMK +++ +        +L  + YL +P   + +GV+AQ+++ 
Sbjct: 249 GGLMNVASTLPFFLSDERMKKDIRRLPTEVMSGVHLATWEYLHEP-GRRYLGVVAQDVAA 307

Query: 114 IRPDTVVENNQGIKSV 129
           + P  V     G+  V
Sbjct: 308 VAPHLVRTGPGGMLLV 323


>gi|163786012|ref|ZP_02180460.1| hypothetical protein FBALC1_12542 [Flavobacteriales bacterium
           ALC-1]
 gi|159877872|gb|EDP71928.1| hypothetical protein FBALC1_12542 [Flavobacteriales bacterium
           ALC-1]
          Length = 647

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/159 (13%), Positives = 53/159 (33%), Gaps = 17/159 (10%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +  L      +      +          +  GI  +      S   + +         G 
Sbjct: 460 NGALKNSTTGSYNTGVGNDALNNVTTGSNNIGIGADSRVPNASGSHQVRIGNTQISYAGI 519

Query: 69  QL-APLVSDRRMKCNVKPV-------ANLYQYRY--LSDPKNVQRIGVIAQEISKIRPDT 118
           Q+   + SD+R K N++ +         L    Y   ++    + +G IAQ++  +    
Sbjct: 520 QVPWTITSDKRWKDNIRELPYGLNMLMQLQPVDYTRKNNENKTREMGFIAQDLEALLTKV 579

Query: 119 -------VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                  + +++ G  SV Y  +  +     +++++  +
Sbjct: 580 GYTDQGFLTKDDDGYMSVRYNDIIALLTKAIQEQQHIIE 618


>gi|194172900|ref|YP_002003543.1| putative tail fiber protein [Escherichia phage rv5]
 gi|114795938|gb|ABI79112.1| putative tail fiber protein [Escherichia phage rv5]
          Length = 1272

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 43/133 (32%), Gaps = 25/133 (18%)

Query: 42   AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRY 94
            +Q+ +        +  +       +        SDR +K N+       + +  +  Y Y
Sbjct: 1118 SQSNWVWHCGTLPDKSRYLSVNGAVNCTSVNQSSDRDLKDNIAVIPDALEAIRKMKGYTY 1177

Query: 95   LSDPKNVQRIGVIAQEISKIRPDTVV----------ENNQG--------IKSVDYGRLFN 136
                  +   GVIAQE+ +  P+ V            +  G          SVDY  +  
Sbjct: 1178 TLKENGMPYAGVIAQEVLEALPEAVSSFVQRKEIPNPDQDGTPLITEERFYSVDYAAVTG 1237

Query: 137  IGQIQTKQKKNTA 149
            +     +++ +  
Sbjct: 1238 LLVQVCREQDDKI 1250


>gi|320198066|gb|EFW72674.1| Phage tail fiber protein [Escherichia coli EC4100B]
          Length = 519

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 46/153 (30%), Gaps = 18/153 (11%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY-QLAPL 73
           +     P  P      T         +       Q      G          G      +
Sbjct: 363 VAGPAGPAGPQGPKGDTGAPGQGTELLTTANTWTQAQTFNGGINGNLTVTGNGSFNDIQI 422

Query: 74  VSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
            SD+R K N+  +             LY+ +Y +D      +G+IAQ+  K  P+ V E+
Sbjct: 423 RSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSAD-GWQTSVGLIAQDAQKALPELVTED 481

Query: 123 NQ-----GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                      ++Y  +  +     K  ++  +
Sbjct: 482 ADVISGEKRLRLNYNGIIALLVEGFKTLRHEIK 514


>gi|317504681|ref|ZP_07962646.1| cell wall surface anchor family protein [Prevotella salivae DSM
           15606]
 gi|315664208|gb|EFV03910.1| cell wall surface anchor family protein [Prevotella salivae DSM
           15606]
          Length = 807

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 48/155 (30%), Gaps = 13/155 (8%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLS---ERKEGKKEFYDAVN 65
           ++    +          +      +               Q +    R +  +   + + 
Sbjct: 634 NQRALFISESNAVYFGCNDRPLYTLFEGSELQFNIYQNGWQTALIISRDKTAQFHGNVLA 693

Query: 66  MGYQLAPLVSDRRMKCNVKPVANLY-------QYRYLSDPKNVQRIGVIAQEIS-KIRPD 117
           MG   A   SDRR+K N+K V ++         +++         +G IAQ +       
Sbjct: 694 MGGVTAYTTSDRRLKENIKAVDSMKVIRSLGGTWQFDYKGTGEHSVGFIAQNVKGSALKS 753

Query: 118 TVVENNQGIKSVDY--GRLFNIGQIQTKQKKNTAQ 150
            V  N  G   ++Y   RL  +      Q  +  +
Sbjct: 754 MVYTNADGYMKLNYLDTRLIALAFGAAVQVDDKVE 788


>gi|27378597|ref|NP_770126.1| hypothetical protein blr3486 [Bradyrhizobium japonicum USDA 110]
 gi|27351745|dbj|BAC48751.1| blr3486 [Bradyrhizobium japonicum USDA 110]
          Length = 558

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 75  SDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
           SD  +K +V  +  L      YR+     +   +GV+AQE+ +++P+ V   N G   V 
Sbjct: 472 SDIALKHDVVLLGYLANGLGYYRFSYLGSHKAYVGVMAQEVERVKPEAVTRGNDGYLLVH 531

Query: 131 YGRL 134
           Y +L
Sbjct: 532 YDKL 535


>gi|323972453|gb|EGB67660.1| hypothetical protein ERHG_01565 [Escherichia coli TA007]
          Length = 254

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 46/157 (29%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q      +   L   +    +   G+    Y     +  +             
Sbjct: 69  STMTLNTQGTAYAGVTAKLWGNSSRPVVYEVGVDGGAYMFYAQKNTDNTYMLSVNGACHA 128

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 129 TAFNQHSDRDLKDNIQVINNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 188

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 189 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 225


>gi|148724489|ref|YP_001285455.1| tail fiber [Cyanophage Syn5]
 gi|145588134|gb|ABP87953.1| tail fiber [Synechococcus phage Syn5]
          Length = 1351

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 48/133 (36%), Gaps = 12/133 (9%)

Query: 30   PTPIAPIDYAGIAQNIYQNQLSERKEGK-KEFYDAVNMGYQLAPLVSDRRMKCNVKP--- 85
                A    A IA       +              V         +SD  +K N+ P   
Sbjct: 1207 SAQGAGTGQALIAGRHSGTGIGTGSVSFIVYNNGNVLNTNNSYGALSDINLKENIVPASS 1266

Query: 86   ----VANLYQYRYLSDPKNV----QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
                + ++    Y    +      +++GVIAQ++ +I P  V  + +G+KSV+Y  L+  
Sbjct: 1267 QWNNIRDIEIVNYNFKAETGNETNKQLGVIAQQVEEISPGLVNTDAEGVKSVNYSVLYMK 1326

Query: 138  GQIQTKQKKNTAQ 150
                 ++  N  +
Sbjct: 1327 SVKALQEAMNRIE 1339


>gi|320174348|gb|EFW49497.1| Phage tail fiber protein [Shigella dysenteriae CDC 74-1112]
          Length = 469

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 46/153 (30%), Gaps = 18/153 (11%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY-QLAPL 73
           +     P  P         +      +       Q      G          G      +
Sbjct: 313 VAGPAGPAGPQGPKGDIGASGQGTELLTTANTWTQAQTFNGGINGNLTVTGNGSFNDIQI 372

Query: 74  VSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
            SD+R K N+  +             LY+ +Y +D      +G+IAQ+  K  P+ V E+
Sbjct: 373 RSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSAD-GWQTSVGLIAQDAQKALPELVTED 431

Query: 123 NQ-----GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                      ++Y  +  +     K  ++  +
Sbjct: 432 ADVISGEKRLRLNYNGIIALLVEGFKTLRHEIK 464


>gi|331680976|ref|ZP_08381613.1| conserved hypothetical protein [Escherichia coli H299]
 gi|331081197|gb|EGI52358.1| conserved hypothetical protein [Escherichia coli H299]
          Length = 346

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 48/157 (30%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q      +   L   +    +   G+ + +Y     +      E         
Sbjct: 161 STMTLTTQGSAHAGVTTRLWGNSSRPVVYEVGVDEALYMFYAQKTTSNTYELTVNGACNA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 SAFNQGSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQETLEAIPEAVGS 280

Query: 120 -VENNQG-----------IKSVDYGRLFNIGQIQTKQ 144
            ++   G             +VDY  +  +     ++
Sbjct: 281 MMKYPDGGSGLDGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|310722579|ref|YP_003969402.1| hypothetical protein phiAS5_ORF0113 [Aeromonas phage phiAS5]
 gi|306021422|gb|ADM79956.1| hypothetical protein phiAS5_ORF0113 [Aeromonas phage phiAS5]
          Length = 1313

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/139 (12%), Positives = 41/139 (29%), Gaps = 11/139 (7%)

Query: 23   LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
               +          +                     +   + N  +    + SD R+K N
Sbjct: 1168 TNSNNFYVLRSPTANNGNFDSGPGGVHPMTLNLSTGDAQFSRNGSFNDVQIRSDIRLKSN 1227

Query: 83   VKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV----VENNQGIKSVDY 131
             +P+         L    +     + +  G+IAQ++ K+ P+ +        +   +V  
Sbjct: 1228 FEPILNAVDKVCTLSGKTFDKVGCDKREAGIIAQDLEKVLPEAIGSFKNTAGEEYLTVSN 1287

Query: 132  GRLFNIGQIQTKQKKNTAQ 150
              +  +     K+ K   +
Sbjct: 1288 SGVNALLVEAIKELKAEIE 1306


>gi|167377044|ref|XP_001734263.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165904344|gb|EDR29586.1| hypothetical protein EDI_210610 [Entamoeba dispar SAW760]
          Length = 585

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 37/89 (41%), Gaps = 8/89 (8%)

Query: 69  QLAPLVSDRRMKCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVE 121
               + SD R KC+++P       ++ L   +Y        R+G +AQE+ +I PD V  
Sbjct: 199 NGYFVRSDERTKCHIRPLSDCLESISQLVGKQYRYKNSPQLRLGFVAQEVKEILPDLVHT 258

Query: 122 NN-QGIKSVDYGRLFNIGQIQTKQKKNTA 149
           +   G  SVD   +        KQ  +  
Sbjct: 259 DEITGTLSVDVLGIIPFLVESLKQLNSEI 287


>gi|18466716|ref|NP_569523.1| putative phage tail protein [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16506032|emb|CAD09918.1| putative phage tail protein [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
          Length = 850

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 38/102 (37%), Gaps = 16/102 (15%)

Query: 60  FYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRY---LSDPKNVQRI----- 104
           F  A N         SD R+K ++  + N       L    Y    +  ++         
Sbjct: 704 FDHAGNASCNQWISTSDIRLKAHLNDIENAKDKVRTLRGITYYKRNNIVEDKYSYYEIEA 763

Query: 105 GVIAQEISKIRPDTVVE-NNQGIKSVDYGRLFNIGQIQTKQK 145
           G++AQE+ ++ P+ V +  +     V+YG +  +      + 
Sbjct: 764 GLVAQEVQEVLPEAVRKIGDTEFLGVNYGGVVALLVNAINEM 805


>gi|291334867|gb|ADD94506.1| hypothetical protein [uncultured phage MedDCM-OCT-S08-C1441]
          Length = 199

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 41/151 (27%), Gaps = 19/151 (12%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
                +              + G+      N               +         +SD 
Sbjct: 38  ANSNPITARSTAGATTVNEYFTGLHSATQINTGGTVSIKIYTN-GNIQNSNNSYGSLSDA 96

Query: 78  RMKCNV-------KPVANLYQYRYLSDPKNVQ-RIGVIAQEISKIRPDTVVENNQG---- 125
           ++K N+         +  +    Y         ++GV+AQE+  + P  V E        
Sbjct: 97  KLKENIVDASSQWDDIKGIRVRNYNFIEGQTHTQLGVVAQEVETVSPGLVYETPDKDDEG 156

Query: 126 ------IKSVDYGRLFNIGQIQTKQKKNTAQ 150
                  KSV+Y  L+       ++  +  +
Sbjct: 157 VDLGTVTKSVNYSVLYMKAVKALQEAMDRIE 187


>gi|170682042|ref|YP_001743270.1| hypothetical protein EcSMS35_1209 [Escherichia coli SMS-3-5]
 gi|170519760|gb|ACB17938.1| hypothetical protein EcSMS35_1209 [Escherichia coli SMS-3-5]
          Length = 346

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 45/157 (28%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q         SL   +    +   G     Y     +  +             
Sbjct: 161 STMTINTQGTAHSGATTSLWGNSTRPVVYEVGADGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 281 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|322511240|gb|ADX06552.1| hypothetical protein 162310556 [Organic Lake phycodnavirus]
          Length = 377

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/143 (12%), Positives = 42/143 (29%), Gaps = 15/143 (10%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
              +  N +  + +                + +        V          SD R+K N
Sbjct: 202 FYSAAANISNGSIMFVPTSTNGRTHITFKNKTQTGNWGSITVGNSSTYYNTSSDYRLKEN 261

Query: 83  VKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG--------IK 127
           ++ V         L  Y+Y     + + +G +A E+ ++    VV              +
Sbjct: 262 LENVSDALTILNQLKCYKYNFIDSSEKVLGFLAHEVQEVLTGVVVGEKDEIDQSGNPVFQ 321

Query: 128 SVDYGRLFNIGQIQTKQKKNTAQ 150
            +D+ ++        ++     Q
Sbjct: 322 QMDHSKMVPFAISSIQEVNKQLQ 344


>gi|299142843|ref|ZP_07035971.1| hypothetical protein HMPREF0665_02453 [Prevotella oris C735]
 gi|298575711|gb|EFI47589.1| hypothetical protein HMPREF0665_02453 [Prevotella oris C735]
          Length = 878

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 47/155 (30%), Gaps = 13/155 (8%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLS---ERKEGKKEFYDAVN 65
           ++    + +        +      +   D           Q +    R        + + 
Sbjct: 703 NQRALFISSSNTVYFGCNDRPLYTLFEGDELQFNVYNKGWQNALVISRDRTAIFTGNVLA 762

Query: 66  MGYQLAPLVSDRRMKCNVKPVANLY-------QYRYLSDPKNVQRIGVIAQEIS-KIRPD 117
            G   A   SDRR+K N+K V ++         +++         IG IAQ +       
Sbjct: 763 QGGVTAYTTSDRRLKENIKAVDSVKVIRSLGGTWQFDYKDSGEHSIGFIAQSVKGSALRS 822

Query: 118 TVVENNQGIKSVDY--GRLFNIGQIQTKQKKNTAQ 150
            +  N  G   ++Y   RL  +      Q  +  +
Sbjct: 823 MIYTNADGYMKLNYLDTRLIALALGAAVQVDDKVE 857


>gi|156392170|ref|XP_001635922.1| predicted protein [Nematostella vectensis]
 gi|156223020|gb|EDO43859.1| predicted protein [Nematostella vectensis]
          Length = 576

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 13/78 (16%)

Query: 68  YQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPK------NVQRIGVIAQEISKI 114
             L  L SD R+K N+  +         L +  ++   +        +  GVIAQE+  +
Sbjct: 481 IGLGILFSDERLKQNITTIPGADYEAIGLREVEWVWRSQAGPLGLEGRGRGVIAQEVEGL 540

Query: 115 RPDTVVENNQGIKSVDYG 132
            P  V     G K VDYG
Sbjct: 541 YPAAVRLERNGYKRVDYG 558


>gi|42522455|ref|NP_967835.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39574987|emb|CAE78828.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1148

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 42/174 (24%), Gaps = 25/174 (14%)

Query: 2    DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK--- 58
              +   +         V    +  SL   T            N   + L ++        
Sbjct: 931  TLRYGGYSGASGYAGGVGFSPVNGSLYFTTSADAGAADAAVTNSVTHMLIDKNGNVGIGA 990

Query: 59   --------EFYDAVNMGYQLAPLVSDRRMKC-------NVKPVANLYQYRYLSDPKNV-- 101
                        A           SDRR+K         +  +  L   RY     N   
Sbjct: 991  TIPSYKLHVVGTAGLSTGTAWTNASDRRLKDIHGNYEYGLNEILKLRTIRYNYKEGNPLK 1050

Query: 102  -----QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                    G +AQE+  + PD V +   G   ++   +        +      Q
Sbjct: 1051 LPSDVPMTGFVAQEVQAVIPDAVKKREDGYLELNVDPIHWATVNAVQDLHGICQ 1104


>gi|66391732|ref|YP_239257.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB43]
 gi|62288820|gb|AAX78803.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB43]
          Length = 812

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 48/136 (35%), Gaps = 14/136 (10%)

Query: 29  NPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV----- 83
                 P+    +    +      + +     Y   +  +    + SD R+K N+     
Sbjct: 669 YAGGGNPVVVMHVGGADFSFDNGGQFKASGYIYSGAHGDFNDVYIRSDIRLKSNLVELKD 728

Query: 84  --KPVANLYQYRYL------SDPKNVQRIGVIAQEISKIRPDTVVENNQ-GIKSVDYGRL 134
               V  L  Y Y        D  N +  G+IAQ++ K+ P+ V EN + G+ ++    +
Sbjct: 729 ALSKVEQLKGYIYDKKLKVEDDEPNGREAGIIAQDLQKVLPEAVRENEETGMLTISPSSV 788

Query: 135 FNIGQIQTKQKKNTAQ 150
             +      + +   +
Sbjct: 789 NALLITAINELRERLE 804


>gi|85717460|ref|ZP_01048408.1| hypothetical protein NB311A_16474 [Nitrobacter sp. Nb-311A]
 gi|85695706|gb|EAQ33616.1| hypothetical protein NB311A_16474 [Nitrobacter sp. Nb-311A]
          Length = 537

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 4/64 (6%)

Query: 75  SDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
           SD  +K ++  +  L      YR+     +   +GVIAQ++  + P  V     G   V 
Sbjct: 449 SDVHLKDHIVLLGYLANGLGYYRFNYLGNSKTYVGVIAQDVQNLMPQAVTRGRDGYLRVY 508

Query: 131 YGRL 134
           Y +L
Sbjct: 509 YEKL 512


>gi|119386796|ref|YP_917851.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
 gi|119377391|gb|ABL72155.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
          Length = 716

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 33/90 (36%), Gaps = 8/90 (8%)

Query: 64  VNMGYQLAPLVSDRRMKCNVK------PVANLYQYRYLSDPKNVQRIGVIAQEISKIRPD 117
           V          SD R+K +++       +  L  + Y     + +  GVIAQ+ + I P 
Sbjct: 612 VTTSATSYNTSSDGRLKTDLQEFDGLGTINALEVWDYEWVNGSGRGRGVIAQDAALIAPY 671

Query: 118 TVV--ENNQGIKSVDYGRLFNIGQIQTKQK 145
            +   E    + S DY +         +Q 
Sbjct: 672 ALTPGETPDEMWSADYSKFVPDLIRAVQQL 701


>gi|30267425|gb|AAP04369.1| gp 36-37.2 [Enterobacteria phage RB43]
          Length = 812

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 47/133 (35%), Gaps = 14/133 (10%)

Query: 32  PIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV-------K 84
              P+    +    +      +       Y   +  +    + SD R+K N+        
Sbjct: 672 GGNPVVVMHVGGADFSFNSGGQFNASGYIYSGAHGDFNDVYIRSDIRLKSNLVELKDALS 731

Query: 85  PVANLYQYRYL------SDPKNVQRIGVIAQEISKIRPDTVVENNQ-GIKSVDYGRLFNI 137
            V  L  Y Y        D  N +  G+IAQ++ K+ P+ V EN + G+ ++    +  +
Sbjct: 732 KVEQLKGYIYDKKLKVEDDEPNGREAGIIAQDLQKVLPEAVRENEETGMLTISPSSVNAL 791

Query: 138 GQIQTKQKKNTAQ 150
                 + +   +
Sbjct: 792 LITAINELRERLE 804


>gi|300949468|ref|ZP_07163467.1| conserved domain protein [Escherichia coli MS 116-1]
 gi|300451118|gb|EFK14738.1| conserved domain protein [Escherichia coli MS 116-1]
          Length = 168

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 36/118 (30%), Gaps = 26/118 (22%)

Query: 53  RKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIG 105
            +          ++        SDRR+K N++ + N       +  Y Y          G
Sbjct: 3   SRIPGAVHTVNGSVNCTTLNQSSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAG 62

Query: 106 VIAQEISKIRPDTVV-------------------ENNQGIKSVDYGRLFNIGQIQTKQ 144
           VIAQE+ +  P+ V                           +VDY  +  +     ++
Sbjct: 63  VIAQEVEEAIPEAVGSFIHYGEELQGPTVDGNELREETRYLNVDYAAVTGLLVQVARE 120


>gi|149278140|ref|ZP_01884278.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
 gi|149230906|gb|EDM36287.1| cell wall surface anchor family protein [Pedobacter sp. BAL39]
          Length = 317

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/122 (14%), Positives = 39/122 (31%), Gaps = 9/122 (7%)

Query: 32  PIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA---- 87
            +         +    +  SE +   +                SD R+K N+  +     
Sbjct: 159 TLIGSSTPSQGKFTELDVNSELRVTGQVVVTGDIRATGDVTANSDVRLKKNIVTIPPVSE 218

Query: 88  ---NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ--GIKSVDYGRLFNIGQIQT 142
               L+   Y     ++ +IG IAQ + +  P  +  +N      S++Y  +        
Sbjct: 219 SLRRLHAVSYDRKDMDLHQIGFIAQNVQEYFPSLIRTDNDAQKTLSLNYQTMTVPLLKGW 278

Query: 143 KQ 144
           ++
Sbjct: 279 QE 280


>gi|317405694|gb|EFV85990.1| hypothetical protein HMPREF0005_01279 [Achromobacter xylosoxidans
           C54]
          Length = 653

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 32/125 (25%), Gaps = 24/125 (19%)

Query: 43  QNIYQNQLSERKEGKKEFYDAVNMGYQL--APLVSDRRMKCN---------VKPVANLYQ 91
           +N                  ++ +   +      SD R+K +            V  +  
Sbjct: 508 RNAGTTVAVGFMNSANSLVGSIQVTDSITQYNTASDYRLKHDVAATPIAESYSRVMGVRV 567

Query: 92  YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG-------------IKSVDYGRLFNIG 138
             Y      ++  G IA E+  + P  V                    + VDY ++    
Sbjct: 568 VDYSMADAGIRYRGAIAHELQALIPHAVTGIKDEMIKMPGMEESVPAYQQVDYSKIVPDL 627

Query: 139 QIQTK 143
               +
Sbjct: 628 IAALQ 632


>gi|323973899|gb|EGB69071.1| hypothetical protein ERHG_00074 [Escherichia coli TA007]
          Length = 272

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 47/159 (29%), Gaps = 26/159 (16%)

Query: 7   AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
             +   +    VT      S         +D A       +   +  +       +    
Sbjct: 90  TLNTQGTAHAGVTTRLWGNSSRPVVYEVGVDEALYMFYAQKTTSNTYELTVNGACN---- 145

Query: 67  GYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                   SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V
Sbjct: 146 -ASAFNQGSDRDLKDNIQVIDNAIDRIRKMNGYTYTLKENGMPYAGVIAQETLEAIPEAV 204

Query: 120 ---VENNQG-----------IKSVDYGRLFNIGQIQTKQ 144
              ++   G             +VDY  +  +     ++
Sbjct: 205 GSMMKYPDGGSGLDGEEGERYYTVDYSGVTGLLVQVARE 243


>gi|32469426|ref|NP_862890.1| PblB [Streptococcus phage SM1]
 gi|10732859|gb|AAG18640.1| PblB [Streptococcus phage SM1]
          Length = 1062

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 38/120 (31%), Gaps = 15/120 (12%)

Query: 46   YQNQLSERKEGKKEFYDAVNMGYQLAPLV----SDRRMKCNVKP--------VANLYQYR 93
            Y  Q    +E     Y   +        +    SDRR K N+K         +  L  Y 
Sbjct: 937  YSPQYKRMEESNNYLYLYRDGSSYSWIPMNKEISDRRYKSNIKDSQVSGLDIIEQLKTYS 996

Query: 94   YLSDPKNVQR---IGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            Y  +          G++AQ++ K  P+   EN  G  S     L        ++     Q
Sbjct: 997  YRKEYDGKIEDISCGIMAQDVQKYVPEAFFENPDGAYSYRTFELVPYLIKAIQELNQKIQ 1056


>gi|91214083|ref|YP_544069.1| hypothetical protein UTI89_C5138 [Escherichia coli UTI89]
 gi|91075657|gb|ABE10538.1| hypothetical protein UTI89_C5138 [Escherichia coli UTI89]
          Length = 346

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 44/157 (28%), Gaps = 21/157 (13%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
             +    Q         SL   +    +   G     Y     +  +             
Sbjct: 161 STMTLNTQGTAHSGATTSLWGNSTRPVVYEVGADGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ------------VENNQGIKSVDYGRLFNIGQIQTKQ 144
                        E  +   +VDY  +  +     ++
Sbjct: 281 AMKYQDGAGGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|307710000|ref|ZP_07646446.1| hypothetical protein SMSK564_1275 [Streptococcus mitis SK564]
 gi|307619258|gb|EFN98388.1| hypothetical protein SMSK564_1275 [Streptococcus mitis SK564]
          Length = 694

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 34/92 (36%), Gaps = 11/92 (11%)

Query: 70  LAPLVSDRRMKCNVKP--------VANLYQYRYLSDPKNVQR---IGVIAQEISKIRPDT 118
                SDRR+K N++         +  L  Y Y  +  N       G++AQ++ K  PD 
Sbjct: 596 AWNDTSDRRLKSNIQESSVSGVDVINRLKTYSYRKEFNNEVEDISCGIMAQDVQKYAPDA 655

Query: 119 VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             E   G+ + +   L        ++     +
Sbjct: 656 FREGPDGVYTYNTFALVPYLIKAIQELNQKIE 687


>gi|304373814|ref|YP_003858559.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB16]
 gi|299829770|gb|ADJ55563.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB16]
          Length = 819

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 44/124 (35%), Gaps = 14/124 (11%)

Query: 41  IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYR 93
           +    +    +         Y +VN  +    + SD R+K N+         V  L  Y 
Sbjct: 688 VGGGEFNFTAAGTLTVTGGIYASVNGDFNDVYIRSDIRLKSNLVELKDALSKVEQLKGYI 747

Query: 94  YLSD------PKNVQRIGVIAQEISKIRPDTVVENNQ-GIKSVDYGRLFNIGQIQTKQKK 146
           Y             +  G+IAQ++ K+ P+ V EN   G+ ++    +  +      + +
Sbjct: 748 YDKKLNVEDEEPQHREAGIIAQDLQKVLPEAVKENEDTGMLTISPSGVNALLVNAINELR 807

Query: 147 NTAQ 150
              +
Sbjct: 808 ERLE 811


>gi|311993249|ref|YP_004010115.1| gp37 long tail fiber, distal subunit [Enterobacteria phage CC31]
 gi|284178087|gb|ADB81753.1| gp37 long tail fiber, distal subunit [Enterobacteria phage CC31]
          Length = 870

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 45/113 (39%), Gaps = 11/113 (9%)

Query: 48  NQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN---------LYQYRYLSDP 98
                       +   V +      L SD  +K +++ + +         + +Y    D 
Sbjct: 744 RNGGAHIWNNSSYTSPVQINAPEFYLTSDISLKKDIRSIEDSRSNLHKVEIKRYAMK-DG 802

Query: 99  KNVQRIGVIAQEISKIRPDTVVENNQ-GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            N   IGVIAQE+ ++ P+ V EN   G  SV+Y  L ++     +++    +
Sbjct: 803 SNDNAIGVIAQEVQEVYPELVNENKDTGKLSVNYRGLSSVLWKIVQEQDKELE 855


>gi|158422473|ref|YP_001523765.1| hypothetical protein AZC_0849 [Azorhizobium caulinodans ORS 571]
 gi|158329362|dbj|BAF86847.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 367

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 40/121 (33%), Gaps = 6/121 (4%)

Query: 24  PISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV 83
           PI+    T  +         +                    +    L   +SDRR K ++
Sbjct: 244 PIAGAGGTTQSTSTQPQSLLSNILGGALGLGSLFSAPAGGTSAIGGLL-ALSDRRAKEDI 302

Query: 84  KPVANLY----QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQ 139
             V  L+     YR+         IG++AQ++ K  P+ V  +  G   VDYG       
Sbjct: 303 AQVGELFDGQPVYRFRYKGAPETHIGLMAQDVMKAVPEAV-GDMGGFLGVDYGAATARAA 361

Query: 140 I 140
            
Sbjct: 362 E 362


>gi|312262736|gb|ADQ53031.1| probably distal tail fiber protein [Aeromonas phage PX29]
          Length = 1384

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 41/125 (32%), Gaps = 11/125 (8%)

Query: 33   IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV------ 86
             +  +  G                  +   + N  +    + SD R+K N+  +      
Sbjct: 1249 SSGANGTGWDGGPNGIHPMSLNLADGDVQFSRNGSFNDVQIRSDIRLKSNLIDIKGALDK 1308

Query: 87   -ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV----VENNQGIKSVDYGRLFNIGQIQ 141
              +L    +     + +  G+IAQ++ K+ P+ V        +   +V    +  +    
Sbjct: 1309 VCSLTGKTFDKFGCDKREAGIIAQDLQKVLPEAVGSFKNTAGEEYLTVSNSGVNALLVEA 1368

Query: 142  TKQKK 146
             K+ +
Sbjct: 1369 IKELR 1373


>gi|291336082|gb|ADD95668.1| hypothetical protein [uncultured phage MedDCM-OCT-S11-C561]
          Length = 1000

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 41/151 (27%), Gaps = 19/151 (12%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
                +              + G+      N               +         +SD 
Sbjct: 839 ANSNPITARSTAGATTVNEYFTGLHSATQINTGGTVSIKIYTN-GNIQNSNNSYGSLSDA 897

Query: 78  RMKCNV-------KPVANLYQYRYLSDPKNVQ-RIGVIAQEISKIRPDTVVENNQG---- 125
           ++K N+         +  +    Y         ++GV+AQE+  + P  V E        
Sbjct: 898 KLKENIVDASSQWDDIKGIRVRNYNFIEGQTHTQLGVVAQEVETVSPGLVYETPDKDDEG 957

Query: 126 ------IKSVDYGRLFNIGQIQTKQKKNTAQ 150
                  KSV+Y  L+       ++  +  +
Sbjct: 958 VDLGTVTKSVNYSVLYMKAVKALQEAMDRIE 988


>gi|82543711|ref|YP_407658.1| tail fiber protein [Shigella boydii Sb227]
 gi|81245122|gb|ABB65830.1| putative tail fiber protein [Shigella boydii Sb227]
          Length = 195

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 45/153 (29%), Gaps = 18/153 (11%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY-QLAPL 73
           +     P  P      T         +       Q      G          G      +
Sbjct: 39  VAGPAGPAGPQGPKGDTGAPGQGTELLTTANTWTQAQTFNGGINGNLTVTGNGSFNDIQI 98

Query: 74  VSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
            SD+R K N+  +             LY+ +Y +D      +G+IAQ+  K  P  V E+
Sbjct: 99  RSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSAD-GWQTSVGLIAQDAQKALPKLVTED 157

Query: 123 NQ-----GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                      ++Y  +  +     K  ++  +
Sbjct: 158 ADVISGEKRLRLNYNGIIALLVEGFKTLRHEIK 190


>gi|42524565|ref|NP_969945.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
           HD100]
 gi|39576774|emb|CAE80938.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
           HD100]
          Length = 922

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 42/149 (28%), Gaps = 15/149 (10%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
                   +  L       T  A +     A   +    +           A        
Sbjct: 720 TGGNAGSNLSILRYDDTGATLGAAVT-IDRASGFFGINTAAPAYNIHVTGTAGLSTGSAW 778

Query: 72  PLVSDRRMKC-------NVKPVANLYQYRYLSD-------PKNVQRIGVIAQEISKIRPD 117
            + SD R+K         +  +  L+  RY          P +V  +G IAQE+ ++ PD
Sbjct: 779 TVASDARLKDVHGDYEFGLSEILKLHTVRYNYKKDNAAKIPSDVPMVGFIAQEVQQVIPD 838

Query: 118 TVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
            V     G   ++   +        K+  
Sbjct: 839 AVKTRADGYLELNVDPIHWATVNAVKELH 867


>gi|254503151|ref|ZP_05115302.1| hypothetical protein SADFL11_3190 [Labrenzia alexandrii DFL-11]
 gi|222439222|gb|EEE45901.1| hypothetical protein SADFL11_3190 [Labrenzia alexandrii DFL-11]
          Length = 208

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 48/131 (36%), Gaps = 14/131 (10%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
            V++    +             AGI   +  N L  R   ++      +         SD
Sbjct: 55  GVSIGISSLVALKIGINVGSAMAGIIAILDNNGLYNRDSLEQIAGSTQHAHSNGGGFGSD 114

Query: 77  RRMKCNVKPVANL-------YQYRYLSDPKNVQRIGVIAQEI--SKIRPDTVVENNQ--- 124
           RR+K +V+ + +L       Y + Y ++P   + +GV+AQ++   +     V        
Sbjct: 115 RRIKTDVQLIGHLDHLELDVYSWEYTNEP-GARYVGVMAQDLLAREDLSHAVFIFEDGPH 173

Query: 125 -GIKSVDYGRL 134
            G   VDY  L
Sbjct: 174 KGFYGVDYSVL 184


>gi|163753093|ref|ZP_02160217.1| hypothetical protein KAOT1_13072 [Kordia algicida OT-1]
 gi|161326825|gb|EDP98150.1| hypothetical protein KAOT1_13072 [Kordia algicida OT-1]
          Length = 520

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 24/164 (14%), Positives = 48/164 (29%), Gaps = 29/164 (17%)

Query: 10  EILSLMQNVTVPKLPISLNNP-TPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
            + +L+ +         +       A +        IY    ++       F   V +  
Sbjct: 238 GVRALVTDNGSDGPTYGIFGSVDSSADVKNPAFGAAIYGTSATDSNRFAGYFNGNVFVTG 297

Query: 69  QLAPLVSDRRMKCNV-------KPVANLYQYRYLSDPKNV------QRIGVIAQEISKIR 115
                 SD ++K N+       + +A L    Y              + G +AQ I ++ 
Sbjct: 298 T--FTASDEKLKDNIKEEKNVLEKLAQLNAVTYTFKSNKELNLSSDVQHGFLAQNIEEVF 355

Query: 116 PDTVV-------------ENNQGIKSVDYGRLFNIGQIQTKQKK 146
           P+ V               +    K+V+Y  L +I      +  
Sbjct: 356 PELVTTIQKPIVVEGSKNTDIYEYKAVNYTGLISILTSSVIELN 399


>gi|92116480|ref|YP_576209.1| hypothetical protein Nham_0885 [Nitrobacter hamburgensis X14]
 gi|91799374|gb|ABE61749.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 541

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 75  SDRRMKCNVKPVANLYQ----YRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
           SD ++K ++  +  L      YR+     +   +GVIAQE+  + P  V   + G   V 
Sbjct: 453 SDVKLKHDIVLLGYLANGLGYYRFSYLGSSESYVGVIAQEVQSLVPQAVTRGSDGYLRVY 512

Query: 131 YGRL 134
           Y +L
Sbjct: 513 YEKL 516


>gi|163789031|ref|ZP_02183475.1| hypothetical protein FBALC1_09497 [Flavobacteriales bacterium
           ALC-1]
 gi|159875695|gb|EDP69755.1| hypothetical protein FBALC1_09497 [Flavobacteriales bacterium
           ALC-1]
          Length = 636

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 52/149 (34%), Gaps = 17/149 (11%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
           +SL        +  +      I        A+N         ++   + Y          
Sbjct: 464 VSLGFGTGSVIIGNAAAANLGID--SNEIQARNAGLASNLYLQQNGGDVYV-----GNAI 516

Query: 72  PLVSDRRMKCNVKPVAN---------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
              SDRR+K ++K ++            +Y +    +N + +G+IAQE++ I  + V  N
Sbjct: 517 VHSSDRRLKRDIKDISYGLDEVLKLRPTEYFWKGKTQNHKSLGLIAQEVNDIIKNVVTYN 576

Query: 123 NQ-GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            +     V Y  L  +     +++    +
Sbjct: 577 EEQDKYGVSYTELIPVLIKAIQEQNKIIE 605


>gi|163786013|ref|ZP_02180461.1| outer membrane protein, putative [Flavobacteriales bacterium ALC-1]
 gi|159877873|gb|EDP71929.1| outer membrane protein, putative [Flavobacteriales bacterium ALC-1]
          Length = 594

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 43/134 (32%), Gaps = 11/134 (8%)

Query: 28  NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---- 83
            N   I  +      Q    +           F  A N        +SDR++K ++    
Sbjct: 425 TNALSIRRLSNGRSWQFHVTSDGYLTLFNDGAFRGAFNATTGTYLQISDRKLKKDITTLE 484

Query: 84  ----KPVANLYQYRYLSDP--KNVQRIGVIAQEISKIRPDTVVE-NNQGIKSVDYGRLFN 136
                 V  L    YL        +  G+I+QE+ +I P          + ++ Y  L  
Sbjct: 485 GGTLNKVLQLNPVSYLMKDQTDTKRNHGLISQEVKEIFPSITHYVKESDLLTLSYTELIP 544

Query: 137 IGQIQTKQKKNTAQ 150
           I     ++++   +
Sbjct: 545 ILIKAIQEQQQIIK 558


>gi|241667087|ref|YP_002985171.1| hypothetical protein Rleg_7204 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862544|gb|ACS60209.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 224

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 76  DRRMKCNVKPVAN------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
           DRR+K  V+ +        +Y +RY+        IG +AQ++   RPD V++   G   V
Sbjct: 111 DRRLKTQVRRIGTSPSGIPVYAFRYIW--GGPLFIGTMAQDLLLTRPDAVLQTASGYYMV 168

Query: 130 DYGRL 134
            Y +L
Sbjct: 169 SYEKL 173


>gi|300925980|ref|ZP_07141805.1| hypothetical protein HMPREF9548_04008 [Escherichia coli MS 182-1]
 gi|300417962|gb|EFK01273.1| hypothetical protein HMPREF9548_04008 [Escherichia coli MS 182-1]
          Length = 346

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 45/157 (28%), Gaps = 24/157 (15%)

Query: 12  LSLMQNVTVPKLPISLN---NPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
            ++  N                +    +   G+    Y     +  +             
Sbjct: 161 STMTLNTQGTAYSGVSTLLWGNSSRPVVYEVGVDGGAYMFYAQKNTDNTYMLSVNGACHA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                 SDR +K N++ + N       +  Y Y      +   GVIAQE  +  P+ V  
Sbjct: 221 TAFNQHSDRDLKDNIQVIDNATDRIRKMNGYTYTLKENGMPYAGVIAQEALEAIPEVVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      E  +G    +VDY  +  +     ++
Sbjct: 281 AMKYQDGASGSEGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|85716604|ref|ZP_01047574.1| putative membrane-anchored cell surface protein [Nitrobacter sp.
           Nb-311A]
 gi|85696605|gb|EAQ34493.1| putative membrane-anchored cell surface protein [Nitrobacter sp.
           Nb-311A]
          Length = 684

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 43/140 (30%), Gaps = 15/140 (10%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +   L    +N   +     +G+            + G        N         SD
Sbjct: 514 GSSPGILASVNSNYGQVQIRAGSGMVSGNSF--QLFYRNGSVVGDINYNGTGVTYATTSD 571

Query: 77  RRMKCNVKPVANLYQ----------YRYLSDPKNVQRIGVIAQEISKIRPDTVVE--NNQ 124
            R+K         +           Y + S P  V  +GV AQ   K+ P  V +  +  
Sbjct: 572 ERLKTKFDKSGIDWGRRLDELWVGDYEFKSRP-GVTMLGVTAQRTEKVFPQAVHKPSSEG 630

Query: 125 GIKSVDYGRLFNIGQIQTKQ 144
            + +VDYG+L  +     K 
Sbjct: 631 DVWTVDYGQLSPLALWGAKD 650


>gi|3915245|sp|Q38394|VG37_BPK3 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
            AltName: Full=Receptor-recognizing protein
 gi|15111|emb|CAA28445.1| unnamed protein product [Enterobacteria phage K3]
          Length = 1243

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 49/153 (32%), Gaps = 17/153 (11%)

Query: 8    FHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQ-NIYQNQLSERKEGKKEFYDAVNM 66
             +++ S   N +      S+        I   G    +IY N     +    + Y   N+
Sbjct: 1077 VNQMNSFGVNTSNALGGNSITFGDTDTGIKQNGDGLLDIYANNAQVFRFQNGDLYSYKNI 1136

Query: 67   GYQLAPLVSDRRMKCNVKPVAN-------LYQY-----RYLSDPKNVQRIGVIAQEISKI 114
                  + SD R+K N KP+ N       L         Y+         G++AQ +  +
Sbjct: 1137 NAPNVYIRSDIRLKSNFKPIENALDKVEKLNGVIYDKAEYIGGEAIETEAGIVAQTLQDV 1196

Query: 115  RPDTVVENNQ----GIKSVDYGRLFNIGQIQTK 143
             P+ V E        I +V       +     K
Sbjct: 1197 LPEAVRETEDSKGNKILTVSSQAQIALLVEAVK 1229


>gi|53802955|ref|YP_115302.1| hypothetical protein MCA2909 [Methylococcus capsulatus str. Bath]
 gi|53756716|gb|AAU91007.1| hypothetical protein MCA2909 [Methylococcus capsulatus str. Bath]
          Length = 492

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 44/157 (28%), Gaps = 22/157 (14%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSER-----KEGKKEFYDAVNMGYQL 70
                                +  G       +             +             
Sbjct: 330 AANQFNADFFQATQDVGYRFANSPGSYAMTSTDGGVRVPVGGGFHVRNTSLAYAPCYASA 389

Query: 71  APLVSDRRMK-------CNVKPVANLYQYRYLSDPKNVQ---RIGVIAQEISKIRPDTVV 120
             + S+RR+K         ++ V  L   RY  +    Q    +G+IA++  ++ P+ V 
Sbjct: 390 FTVSSNRRLKRVLGEVRHALERVRALQPIRYRLEADGPQGRIELGLIAEDAREVLPEVVY 449

Query: 121 ENNQG-------IKSVDYGRLFNIGQIQTKQKKNTAQ 150
               G         S+DYGRL  +     ++ +   +
Sbjct: 450 PVTDGANGPDGASLSIDYGRLAVLALAAIRELEARVE 486


>gi|148557354|ref|YP_001264936.1| hypothetical protein Swit_4460 [Sphingomonas wittichii RW1]
 gi|148502544|gb|ABQ70798.1| hypothetical protein Swit_4460 [Sphingomonas wittichii RW1]
          Length = 424

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 56/149 (37%), Gaps = 16/149 (10%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTP--------IAPIDYAGIAQNIYQNQLSER 53
            + +Q    + +L     +     +   PT         I  +      Q +     +  
Sbjct: 276 ARSEQIAQMLQALSLTDQLSNAQYAGYGPTTDLLKAGAAIPLMGMDSYQQALANLTNATN 335

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL------YQYRYLS-DPKNVQRIGV 106
               K    A N+    A  +SDRR K N++ V  L      Y + Y+  D    ++ GV
Sbjct: 336 SSTSKGPGIAYNVWSNAASSLSDRRTKTNIEKVGELDDGLGIYDFDYVDLDHGAGRQRGV 395

Query: 107 IAQEISKIRPDTVVEN-NQGIKSVDYGRL 134
           +A E++ +RP  +      G  +VDY +L
Sbjct: 396 MADEVAILRPWALGPRTADGFATVDYKKL 424


>gi|332826387|gb|EGJ99230.1| hypothetical protein HMPREF9455_00554 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 840

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 51/157 (32%), Gaps = 15/157 (9%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
               ++           + N+   I     A       +  +           + ++ G 
Sbjct: 657 SGRDNIAIGDNAGNNITTGNSNIIIGSGTKASSPTATNEIAMGASNHSTIRIGNLLSNGS 716

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSD-PKNVQRIGVIAQEISKIRPD--- 117
               + SDRR+K ++KP+         L    Y+ +     + +G IAQ++ ++  +   
Sbjct: 717 GSWTVTSDRRLKHDIKPIGQGLDFIKKLKPVEYIYNTGNGKKSLGFIAQDLQQVMAEENM 776

Query: 118 ----TVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                VV        +    L  +     ++++ T +
Sbjct: 777 SGYSLVVPTQGDTLGITSTELIPVLTKAIQEQQVTIE 813


>gi|187731452|ref|YP_001879749.1| side tail fiber protein [Shigella boydii CDC 3083-94]
 gi|187428444|gb|ACD07718.1| side tail fiber protein [Shigella boydii CDC 3083-94]
          Length = 411

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/139 (16%), Positives = 43/139 (30%), Gaps = 18/139 (12%)

Query: 29  NPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY-QLAPLVSDRRMKCNVKPV- 86
             T         +       Q      G          G      + SD+R K N+  + 
Sbjct: 269 GDTGAPGQGTELLTTANTWTQAQTFNGGINGNLTVTGNGSFNDIQIRSDKRNKRNLVKLD 328

Query: 87  ----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ-----GIKSVDY 131
                       LY+ +Y +D      +G+IAQ+  K  P+ V E+           ++Y
Sbjct: 329 NALDRLEALTGYLYEIQYSAD-GWQTSVGLIAQDAQKALPELVTEDADVISGEKRLRLNY 387

Query: 132 GRLFNIGQIQTKQKKNTAQ 150
             +  +     K  ++  +
Sbjct: 388 NGIIALLVEGFKTLRHEIK 406


>gi|116222013|ref|YP_794068.1| putative long tail fiber protein [Stx2-converting phage 86]
 gi|115500823|dbj|BAF34053.1| putative long tail fiber protein [Stx2-converting phage 86]
          Length = 673

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 47/153 (30%), Gaps = 20/153 (13%)

Query: 17  NVTVPKLPISLNNPTPIAPI-----DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
               P+       P           D  G       N  ++ +    +     N  +   
Sbjct: 515 GPQGPQGVAGPVGPAGEPGAKGDKGDPGGTELLASANTWTQPQTINGDLTVTGNGSFNDV 574

Query: 72  PLVSDRRMKCNVKPVAN-------LYQYRY---LSDPKNVQRIGVIAQEISKIRPDTVVE 121
            + SD+R K N   + N       L  Y Y    +D    Q +G+ AQ+  K +P+ V  
Sbjct: 575 QIRSDKRNKRNAIRIDNCLEKLDLLTGYLYEIQNADGSWQQSVGLFAQDALKAQPELVTS 634

Query: 122 NNQGIKS-----VDYGRLFNIGQIQTKQKKNTA 149
           +   I       ++Y  +  +     K  +   
Sbjct: 635 DTDIISGEERFRLNYNGVIALLVEGIKNLRKEI 667


>gi|315612415|ref|ZP_07887328.1| phage minor structural protein [Streptococcus sanguinis ATCC 49296]
 gi|315315396|gb|EFU63435.1| phage minor structural protein [Streptococcus sanguinis ATCC 49296]
          Length = 1036

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 32/87 (36%), Gaps = 11/87 (12%)

Query: 75   SDRRMKCNVKP--------VANLYQYRYLSDPKNVQR---IGVIAQEISKIRPDTVVENN 123
            SDRR K N++         + NL  Y Y  +          G++AQ++ K  P+   EN 
Sbjct: 944  SDRRYKHNIEASTVSGLAVINNLKTYSYRKEYDGKIEDIACGIMAQDVQKYVPEAFYENP 1003

Query: 124  QGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             G  S     L        ++     +
Sbjct: 1004 DGAYSYRTFELVPYLIKAIQELNQKVE 1030


>gi|310722234|ref|YP_003969058.1| small distal tail fiber subunit [Aeromonas phage phiAS4]
 gi|306021077|gb|ADM79612.1| small distal tail fiber subunit [Aeromonas phage phiAS4]
          Length = 907

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 43/126 (34%), Gaps = 20/126 (15%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRYLSD 97
               +   +           N+      + SDRR+K N        + V+ L  Y Y   
Sbjct: 775 GGDFRFHTQGLASYAGIMTGNVNANDVYIRSDRRLKKNFVEVRDALRKVSALTAYSYDKK 834

Query: 98  ------PKNVQRIGVIAQEISKIRPDTVV-------ENNQGIKSVDYGRLFNIGQIQTKQ 144
                   + + +G+IAQ++ ++ P+ V        ++   I ++    L  +     K+
Sbjct: 835 QTLEATEYDKKEVGLIAQDVEQVLPEAVTRVVDSSNKDGTEILTLSNSALIALLVGAVKE 894

Query: 145 KKNTAQ 150
                +
Sbjct: 895 LSEKVK 900


>gi|121602136|ref|YP_988568.1| hypothetical protein BARBAKC583_0235 [Bartonella bacilliformis
           KC583]
 gi|120614313|gb|ABM44914.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 392

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 46/136 (33%), Gaps = 19/136 (13%)

Query: 3   QKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
           Q+ QA++ +  L+                         + ++   + +      K     
Sbjct: 221 QENQAWNRLEKLL---QAGVASAGNYGTKTGQSTTMPSVTKDPLSDAMRWLGLIKG---- 273

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPVANLYQY---RYLSDPKNVQRIGVIAQEISKIRPDTV 119
                      +SD RMK N+ P+     Y    +       +  GVIAQ++ ++ PD V
Sbjct: 274 --------VAGLSDVRMKDNIVPIGQKNGYPLYEFNYKGGAQRYRGVIAQDVLRLNPDAV 325

Query: 120 VENN-QGIKSVDYGRL 134
             +    +  V Y +L
Sbjct: 326 HCDEKTRLLYVYYNKL 341


>gi|303279701|ref|XP_003059143.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458979|gb|EEH56275.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 723

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 45/136 (33%), Gaps = 16/136 (11%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
            +   T     +++   +  A       A        +     K+ + +       L   
Sbjct: 538 TVTGATSITGDVTV-KASGGASTFLVAAATGNTAIAGAHGDASKELYVNGDVYATGLVSS 596

Query: 74  VSDRRMKCNVKPVAN-------LYQYRYLSDPK--------NVQRIGVIAQEISKIRPDT 118
            SD R K +V+ +         L    +    +          +++G IAQE+    PD 
Sbjct: 597 ASDGRYKRDVQNITGALETTRALRAVSFAFQTEAYPEKNFPTERQVGFIAQELEAALPDV 656

Query: 119 VVENNQGIKSVDYGRL 134
           V  ++ G K + Y RL
Sbjct: 657 VTTDSDGYKGIAYERL 672


>gi|300940788|ref|ZP_07155329.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300454453|gb|EFK17946.1| conserved hypothetical protein [Escherichia coli MS 21-1]
          Length = 122

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 31/104 (29%), Gaps = 18/104 (17%)

Query: 62  DAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKI 114
               +        SD R+K  V  + +       L    +         IG IAQ++ KI
Sbjct: 4   TGNAVAPGAWVPNSDGRLKDGVSRIGDPLSKMEMLKGCSWTRKDTGQWGIGFIAQDVKKI 63

Query: 115 RPDTVVENNQ----------GIKSVD-YGRLFNIGQIQTKQKKN 147
            P  V E             G+ S D YG    +         N
Sbjct: 64  FPQAVTEGGDRQLPDGTMVEGVLSPDTYGVAAALHHEAILVLMN 107


>gi|163786018|ref|ZP_02180466.1| putative YapH protein [Flavobacteriales bacterium ALC-1]
 gi|159877878|gb|EDP71934.1| putative YapH protein [Flavobacteriales bacterium ALC-1]
          Length = 553

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/140 (14%), Positives = 44/140 (31%), Gaps = 23/140 (16%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN----- 88
              +      ++  +  +  + G                  SD+R K N+K +       
Sbjct: 379 TGSNQLSFGASVIPDTNNAYRLGNSSSRWIGVWATDGTINTSDKREKKNIKELNYGLAEV 438

Query: 89  --LYQYRYLSDPKNVQRI--GVIAQEISKIRPDTVVEN---NQGI-----------KSVD 130
             +    +    KN   +  G+IAQ++  + P+ V  +      I             V 
Sbjct: 439 LQMQPVSFNWKNKNNPDLKLGLIAQDLQTLIPEVVKSHTWEKDEISGQLTKKELERLGVY 498

Query: 131 YGRLFNIGQIQTKQKKNTAQ 150
           Y  L  +     K++++  +
Sbjct: 499 YSDLVPVLINAIKEQQDQIK 518


>gi|94967383|ref|YP_589431.1| hypothetical protein Acid345_0352 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549433|gb|ABF39357.1| hypothetical protein Acid345_0352 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 1037

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 30/140 (21%), Positives = 52/140 (37%), Gaps = 12/140 (8%)

Query: 19  TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
            +    +   +P   +     G  Q          K         +N   +L    S RR
Sbjct: 860 NLYIGNVGCTSPCTESATIRIGNTQTSAFMTGIAGKTSSSGITVLINSTGKLGTTTSSRR 919

Query: 79  MKCNVKPVA------NLYQYRY-----LSDPKNVQRIGVIAQEISKIRPDTVVENNQGI- 126
            K N+  +        L    +       D  +V++ G+IA+E++KI PD VV +NQG  
Sbjct: 920 FKQNIANIPDSSKLFQLRPVTFFYRPEYDDGTHVRQYGLIAEEVAKIYPDLVVFDNQGKP 979

Query: 127 KSVDYGRLFNIGQIQTKQKK 146
            +V Y  L  +     +++ 
Sbjct: 980 YTVRYQFLAPLLLDAMQKEH 999


>gi|315252540|gb|EFU32508.1| conserved hypothetical protein [Escherichia coli MS 85-1]
          Length = 265

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 43/158 (27%), Gaps = 28/158 (17%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +    L    +   + I +   +    +   G +                    +  +  
Sbjct: 58  NRFALLNSGNSELPVSIRVWGSSTRQNVFEVGTSAAYLFYAQKTTDGQNLTVNGS--VNC 115

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV- 120
                 SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V  
Sbjct: 116 TTLNQSSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAVGS 175

Query: 121 ------------------ENNQGIKSVDYGRLFNIGQI 140
                                    +VDY  +  +   
Sbjct: 176 FIHYGEELQGPTVDGNELREETRYLNVDYAAVTGLLVQ 213


>gi|260432545|ref|ZP_05786516.1| hypothetical protein SL1157_1676 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416373|gb|EEX09632.1| hypothetical protein SL1157_1676 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 441

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 45/140 (32%), Gaps = 14/140 (10%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM----GYQLAPL 73
             +     +  + T +   +   I  N          + + +      +       +   
Sbjct: 290 AGIIWANSTRTHNTEMMASEVGTIVLNRRGTTNPFFFDFRVDNTTVGAIRYDGTNTVFQT 349

Query: 74  VSDRRMKCNVKP-------VANLYQYRYLSDPKN-VQRIGVIAQEISKIRPDTVVE--NN 123
            SDR +K N+ P       +  L   ++           GVIAQ++ ++ PD V     +
Sbjct: 350 TSDRALKENIAPAGDAGAIIDALEVVQHDWIANGAHTSFGVIAQDVHEVFPDAVSPASED 409

Query: 124 QGIKSVDYGRLFNIGQIQTK 143
                VDY R   +   + K
Sbjct: 410 TEFWMVDYSRFTPLLLQEVK 429


>gi|313203565|ref|YP_004042222.1| hypothetical protein Palpr_1089 [Paludibacter propionicigenes WB4]
 gi|312442881|gb|ADQ79237.1| hypothetical protein Palpr_1089 [Paludibacter propionicigenes WB4]
          Length = 3138

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/147 (12%), Positives = 39/147 (26%), Gaps = 11/147 (7%)

Query: 7    AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
            A + I                     +   D  G         +                
Sbjct: 2950 AANNIWCFASATPYGMSYYQGTALVGVG--DAIGFHFGNQAAPVFYVNATGNAVVSGSIT 3007

Query: 67   GYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                    SD R+K N++ + N       +    +      + ++G IAQ + +  PD V
Sbjct: 3008 AGGNVTAYSDIRLKKNIQTLPNVSESLRKINAVEFDRKDIKIHQLGFIAQNVQQYFPDLV 3067

Query: 120  VENNQGI--KSVDYGRLFNIGQIQTKQ 144
                  +   S++Y  +        ++
Sbjct: 3068 TIAKDSMSTLSLNYQAMTAPLLKGWQE 3094


>gi|50846098|gb|AAT85007.1| klebicin C phage associated protein [Klebsiella oxytoca]
          Length = 203

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 42/127 (33%), Gaps = 23/127 (18%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------L 89
            + G+       Q           Y             SD RMK  V+ + N       +
Sbjct: 63  HFLGLHVANGGAQGWFEFRNDGHAY-----TNGAWNSSSDARMKTQVEKIDNALEKLDCI 117

Query: 90  YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN----QGI-----KSVDYGRLFNIGQI 140
             Y Y    + V   GVIAQE+ ++ P  V +       G      +S++   +  +   
Sbjct: 118 SGYTY--LKQGVTEAGVIAQELEEVLPQAVSKTELTLNDGSVLKDARSININGVVALLIE 175

Query: 141 QTKQKKN 147
             K+++ 
Sbjct: 176 ALKEERQ 182


>gi|138017|sp|P07067|VG37_BPT2 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
            AltName: Full=Receptor-recognizing protein
 gi|15196|emb|CAA28038.1| unnamed protein product [Enterobacteria phage T2]
          Length = 1341

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 28/151 (18%), Positives = 44/151 (29%), Gaps = 22/151 (14%)

Query: 15   MQNVTVPKLPISLNNPTPIAPIDYAGIAQNI------YQNQLSERKEGKKEFYDAVNMGY 68
                        L   +        GI QN       Y N +   +    + Y   N+  
Sbjct: 1177 QTGAFGVNTSNGLGGNSITFGDSDTGIKQNGDGLLDIYANSVQVFRFQNGDLYSYKNINA 1236

Query: 69   QLAPLVSDRRMKCNVKPVAN-------LYQY-----RYLSDPKNVQRIGVIAQEISKIRP 116
                + SD R+K N KP+ N       L         Y+         G++AQ +  + P
Sbjct: 1237 PNVYIRSDIRLKSNFKPIENALDKVEKLNGVIYDKAEYIGGEAIETEAGIVAQTLQDVLP 1296

Query: 117  DTVVENNQ----GIKSVDYGRLFNIGQIQTK 143
            + V E        I +V       +     K
Sbjct: 1297 EAVRETEDSKGNKILTVSSQAQIALLVEAVK 1327


>gi|138016|sp|P08232|VG37_BPOX2 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
           AltName: Full=Receptor-recognizing protein
 gi|15125|emb|CAA29157.1| unnamed protein product [Enterobacteria phage Ox2]
          Length = 251

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 50/156 (32%), Gaps = 17/156 (10%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
              +  V +    ++ N    I  +  A  +                 FY   N  +   
Sbjct: 76  QGFVTAVDLGIRRVNNNWGQAIIRVGSAEASPAAGHPNAVFEFHYDGTFYSPGNGNFSDV 135

Query: 72  PLVSDRRMKCN--------VKPVANLYQYRY------LSDPKNVQRIGVIAQEISKIRPD 117
            + SD R+K N        ++ V  L  Y Y             + +G+IAQ++ K  P+
Sbjct: 136 YIRSDGRLKINKKELENGALEKVCRLKVYTYDKVKSIKDRSVIKREVGIIAQDLEKELPE 195

Query: 118 TVVE---NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            V +   +   + ++    +  +     ++     +
Sbjct: 196 AVSKVEVDGSDVLTISNSAVNALLIKAIQEMSEEIK 231


>gi|300955526|ref|ZP_07167889.1| prophage tail fibre [Escherichia coli MS 175-1]
 gi|300317582|gb|EFJ67366.1| prophage tail fibre [Escherichia coli MS 175-1]
          Length = 1261

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 45/162 (27%), Gaps = 28/162 (17%)

Query: 9    HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
            +    L    +   + I +   +    +   G +                    +  +  
Sbjct: 1054 NRFALLNSGNSELPVSIRVWGSSTRQNVFEVGTSAAYLFYAQKTTDGQNLTVNGS--VNC 1111

Query: 69   QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV- 120
                  SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V  
Sbjct: 1112 TTLNQSSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAVGS 1171

Query: 121  ------------------ENNQGIKSVDYGRLFNIGQIQTKQ 144
                                     +VDY  +  +     ++
Sbjct: 1172 FIHYGEELQGPTVDGNELREETRYINVDYAAVTGLLVQVARE 1213


>gi|109290124|ref|YP_656373.1| gp12 short tail fibers [Aeromonas phage 25]
 gi|104345797|gb|ABF72697.1| gp12 short tail fibers [Aeromonas phage 25]
          Length = 465

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/169 (13%), Positives = 48/169 (28%), Gaps = 20/169 (11%)

Query: 2   DQKQQAF--HEILSLMQNVTVPKLPISLNNPTPIAPIDYAG-----IAQNIYQNQLSERK 54
            +  Q    +    L             N+    A  D          +    +      
Sbjct: 291 TENNQGILWNRNSDLAAITFKNDSDADTNSYLLFAVGDNNNEYFRWTTRTNGVDTTIATL 350

Query: 55  EGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA-------------NLYQYRYLSDPKNV 101
                 + A N+      +  D R+K +++P+                       +    
Sbjct: 351 RPGGHLWLAGNIDINDMYVRCDTRLKTDIQPIKDALVKIDSLDAGIYTKHKSLTDNTVIG 410

Query: 102 QRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           +  G+ AQ++ K+ P+ V   + G  +V    L  +     K+ K+  +
Sbjct: 411 KEAGIFAQQLQKVLPEGVKTLDDGTLTVSPMSLIALLIEANKELKSRLE 459


>gi|315252835|gb|EFU32803.1| conserved domain protein [Escherichia coli MS 85-1]
          Length = 625

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 43/158 (27%), Gaps = 28/158 (17%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +    L    +   + I +   +    +   G +                    +  +  
Sbjct: 418 NRFALLNSGNSELPVSIRVWGSSTRQNVFEVGTSAAYLFYAQKTTDGQNLTVNGS--VNC 475

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV- 120
                 SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V  
Sbjct: 476 TTLNQSSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAVGS 535

Query: 121 ------------------ENNQGIKSVDYGRLFNIGQI 140
                                    +VDY  +  +   
Sbjct: 536 FIHYGEELQGPTVDGNELREETRYLNVDYAAVTGLLVQ 573


>gi|313887448|ref|ZP_07821137.1| hypothetical protein HMPREF9294_0656 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923090|gb|EFR33910.1| hypothetical protein HMPREF9294_0656 [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 417

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 36/106 (33%), Gaps = 28/106 (26%)

Query: 73  LVSDRRMKCNVKPVAN---------LYQYRY------------------LSDPKNVQRIG 105
           + SD+  K NV+ +           L    Y                      +N    G
Sbjct: 193 ITSDQSAKENVEEIDEDEASRALLKLRPVTYTLKEDNANASDLVSLDKSNFKEQNHHNYG 252

Query: 106 VIAQEISKIRPDTVVENN-QGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           +IAQE+ +I PD V  +       + Y  L  I  +  ++++   +
Sbjct: 253 LIAQEVLEIFPDIVEYDTISQQYGIRYMELIPILIVALQRQQQEIE 298


>gi|67482263|ref|XP_656481.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56473651|gb|EAL51066.1| hypothetical protein EHI_187050 [Entamoeba histolytica HM-1:IMSS]
          Length = 489

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 34/86 (39%), Gaps = 10/86 (11%)

Query: 69  QLAPLVSDRRMKCNVKPVANL---------YQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                 SD+R K  ++ +            Y + Y +D  N +  G +AQE+ KI P+TV
Sbjct: 139 AGFFQRSDQRNKNEIQKITGALEQLKNVVGYSFVYKNDENNQKY-GFMAQELQKIYPNTV 197

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQK 145
                G  S+D   L        K+ 
Sbjct: 198 KVLPDGTLSIDTVALLPYIVSSLKEL 223


>gi|299779191|ref|YP_003734385.1| gp37 long tail fiber distal subunit [Enterobacteria phage IME08]
 gi|281312973|gb|ADA59471.1| receptor-recognizing protein gp37 [Escherichia phage IME08]
 gi|298105920|gb|ADI55564.1| gp37 long tail fiber distal subunit [Enterobacteria phage IME08]
          Length = 1289

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 49/151 (32%), Gaps = 17/151 (11%)

Query: 10   EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQ-NIYQNQLSERKEGKKEFYDAVNMGY 68
            +  +   N T      S+        I   G    +IY N +   +    + Y   N+  
Sbjct: 1125 QTSAFGVNTTNSLGGSSITFGDSDTGIKQNGDGLLDIYANNIQVFRFQNGDLYSYKNINA 1184

Query: 69   QLAPLVSDRRMKCNVKPVANLYQY------------RYLSDPKNVQRIGVIAQEISKIRP 116
                + SD R+K N +P+ N  +              Y+         GVIAQ + ++ P
Sbjct: 1185 PNVYIRSDIRLKSNFRPIENALEKVEQLDGLIYDKAEYIGGEAVQTEAGVIAQSLEEVLP 1244

Query: 117  DTVVENNQ----GIKSVDYGRLFNIGQIQTK 143
            + + E        + +V       +     K
Sbjct: 1245 EAICEAEDIKGNKVLTVSTQAQVALLIEAVK 1275


>gi|94967385|ref|YP_589433.1| hypothetical protein Acid345_0354 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549435|gb|ABF39359.1| hypothetical protein Acid345_0354 [Candidatus Koribacter versatilis
           Ellin345]
          Length = 689

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 49/142 (34%), Gaps = 12/142 (8%)

Query: 20  VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRM 79
           +       ++ +  + I         Y   +     G       +    +L    S RR 
Sbjct: 506 IGSAGCGTSSCSEDSTIRIGSAQTATYIAGIYSESPGPSSASVVIGSNGKLGIPTSSRRF 565

Query: 80  KCNVKPVA------NLYQYRYLSDPK-----NVQRIGVIAQEISKIRPDTVVENNQGI-K 127
           K  +  +        L    +   P+     + ++ G+IA+E++KI PD V+ + +G   
Sbjct: 566 KEQIADIGDSRKLFQLRPVTFFYKPEYDGGAHEKQFGLIAEEVAKIYPDMVINDKEGRPF 625

Query: 128 SVDYGRLFNIGQIQTKQKKNTA 149
           +V Y  L  +     ++     
Sbjct: 626 TVKYQFLAPLMLNAVQKDHAVI 647


>gi|71991056|ref|NP_496262.2| Prion-like-(Q/N-rich)-domain-bearing protein family member (pqn-47)
           [Caenorhabditis elegans]
 gi|50507473|emb|CAA88990.3| C. elegans protein F59B10.1, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
 gi|50507495|emb|CAA88602.3| C. elegans protein F59B10.1, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 931

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 41/138 (29%), Gaps = 20/138 (14%)

Query: 27  LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP- 85
            +          A   Q         + E  K                SD R+K  +   
Sbjct: 435 QDTDIGWQRNGGALYTQGAVSVGTEHQVESAKLTVAGDIYMSGRIINPSDIRLKEAITER 494

Query: 86  --------VANLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENNQGIK 127
                   +  L    Y   P+             R G+IAQE+  + PD V +      
Sbjct: 495 ETAEAIENLLKLRVVDYRYKPEVADIWGLDEQQRHRTGLIAQELQAVLPDAVRDIGD-YL 553

Query: 128 SVDYGRLFNIGQIQTKQK 145
           ++D GR+F    + T+Q 
Sbjct: 554 TIDEGRVFYETVMATQQL 571


>gi|138015|sp|P08231|VG37_BPM1 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
           AltName: Full=Receptor-recognizing protein
 gi|15115|emb|CAA29160.1| unnamed protein product [Enterobacteria phage M1]
          Length = 251

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 49/156 (31%), Gaps = 17/156 (10%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
              +  V +    ++ N    I  +  A                    FY   N  +   
Sbjct: 76  QGFVTAVDLGIRRVNNNWGQAIIRVGSAEACPAAGHPNAVFEFHYDGTFYSPGNGHFNDV 135

Query: 72  PLVSDRRMKCN--------VKPVANLYQYRY------LSDPKNVQRIGVIAQEISKIRPD 117
            + SD R+K N        ++ V  L  Y Y             + +G+IAQ++ K  P+
Sbjct: 136 YIRSDGRLKINKKELENGALEKVCRLKVYTYDKVKSIKDRSVIKREVGIIAQDLEKELPE 195

Query: 118 TVVE---NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            V +   +   + ++    +  +     ++     +
Sbjct: 196 AVSKVEVDGSDVLTISNSAVNALLIKAIQEMSEEIK 231


>gi|240850570|ref|YP_002971970.1| hypothetical protein Bgr_10160 [Bartonella grahamii as4aup]
 gi|240267693|gb|ACS51281.1| hypothetical protein Bgr_10160 [Bartonella grahamii as4aup]
          Length = 351

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 42/111 (37%), Gaps = 8/111 (7%)

Query: 30  PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN- 88
               A     G           + K    E    V         +SD R K N+  V   
Sbjct: 235 AAGGAVAGNYGTQTGQRTTLTPQPKPNPWEIVGNVGTILGTFAGLSDIRAKENIVQVGQR 294

Query: 89  ----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN-QGIKSVDYGRL 134
               LY+Y Y   P+  +  GV+AQ++ K +P+ V  +   G   VDYG+L
Sbjct: 295 DGHKLYEYNYKGYPE--RYRGVMAQDVLKSKPEAVFLHKATGFLHVDYGKL 343


>gi|49476061|ref|YP_034102.1| hypothetical protein BH13970 [Bartonella henselae str. Houston-1]
 gi|49238869|emb|CAF28162.1| hypothetical protein BH13970 [Bartonella henselae str. Houston-1]
          Length = 374

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 53/154 (34%), Gaps = 26/154 (16%)

Query: 3   QKQQAFHEILSLM-QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
           Q  QA++++  L+           + +  +   P       ++  Q              
Sbjct: 220 QDNQAWNQLERLLRVGTQAAGNYGTTSGKSTTMPSVTKDPLRDAQQVLGLMGGILGLC-- 277

Query: 62  DAVNMGYQLAPLVSDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRP 116
                         D R K N+ PV       LY + Y  DP   +  GV+AQE+ +++P
Sbjct: 278 --------------DVRAKENIVPVGEKNGYPLYVFNYKGDP--QRYCGVLAQEVLRLKP 321

Query: 117 DTVVEN-NQGIKSVDYGRLFNIGQIQTKQKKNTA 149
           + V  N    +  VDY +   +   +  + K   
Sbjct: 322 EAVFVNAKTKLLHVDYNK-IGLKMKKISEPKKRI 354


>gi|161622645|ref|YP_001595372.1| gp37 long tail fiber distal subunit [Enterobacteria phage JS98]
 gi|52139851|gb|AAU29223.1| gp37 long tail fiber distal subunit [Enterobacteria phage JS98]
          Length = 1080

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 45/133 (33%), Gaps = 12/133 (9%)

Query: 30   PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN- 88
                           + Q   +         Y   N+      + SD R K  +K + N 
Sbjct: 931  NAYANGQGVFSFRAGLAQTFFNVALHCNAGMYVRDNIDVNDVYIRSDIRCKSEIKLIENA 990

Query: 89   ------LYQYRYLSD----PKNVQRIGVIAQEISKIRPDTVVENNQ-GIKSVDYGRLFNI 137
                  L  Y YL       +     G+IAQE+ ++ P+ V E+ + G+  ++Y  +  +
Sbjct: 991  QEKSKLLGGYTYLLKNSVTDEVKPSAGLIAQEVQEVLPELVTEDKETGLLRLNYNGIIGL 1050

Query: 138  GQIQTKQKKNTAQ 150
                  +  +  +
Sbjct: 1051 NTATINEHTDEIK 1063


>gi|330858765|ref|YP_004415140.1| putative long tail fiber protein [Shigella phage Shfl2]
 gi|327397699|gb|AEA73201.1| putative long tail fiber protein [Shigella phage Shfl2]
          Length = 1311

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 47/148 (31%), Gaps = 17/148 (11%)

Query: 13   SLMQNVTVPKLPISLNNPTPIAPIDYAGIAQ-NIYQNQLSERKEGKKEFYDAVNMGYQLA 71
            +   N +      S+        I   G    +IY N +   +    + Y   N+     
Sbjct: 1150 AFGVNTSNGLGGNSITFGDSDTGIKQNGDGLLDIYANNVQVFRFQNGDLYSYKNINAPNV 1209

Query: 72   PLVSDRRMKCNVKPVAN-------LYQY-----RYLSDPKNVQRIGVIAQEISKIRPDTV 119
             + SD R+K N KP+ N       L         Y+         G++AQ +  + P+ V
Sbjct: 1210 YIRSDIRLKSNFKPIENALDKVEKLNGVIYDKAEYIGGEAIETEAGIVAQTLQDVLPEAV 1269

Query: 120  VENNQ----GIKSVDYGRLFNIGQIQTK 143
             E        I +V       +     K
Sbjct: 1270 RETEDSKGNKILTVSSQAQIALLVEAVK 1297


>gi|301305885|ref|ZP_07211969.1| conserved domain protein [Escherichia coli MS 124-1]
 gi|300838890|gb|EFK66650.1| conserved domain protein [Escherichia coli MS 124-1]
          Length = 801

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 43/158 (27%), Gaps = 28/158 (17%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +    L    +   + I +   +    +   G +                    +  +  
Sbjct: 594 NRFALLNSGNSELPVSIRVWGSSTRQNVFEVGTSAAYLFYAQKTTDGQNLTVNGS--VNC 651

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV- 120
                 SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V  
Sbjct: 652 TTLNQSSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAVGS 711

Query: 121 ------------------ENNQGIKSVDYGRLFNIGQI 140
                                    +VDY  +  +   
Sbjct: 712 FIHYGEELQGPTVDGNELREETRYLNVDYAAVTGLLVQ 749


>gi|163868964|ref|YP_001610193.1| hypothetical protein Btr_1966 [Bartonella tribocorum CIP 105476]
 gi|161018640|emb|CAK02198.1| hypothetical protein BT_1966 [Bartonella tribocorum CIP 105476]
          Length = 379

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 54/153 (35%), Gaps = 26/153 (16%)

Query: 4   KQQAFHEILSLMQ-NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
             Q ++ +  L+Q          + +  + I P       ++  Q               
Sbjct: 221 DNQDWNRLGRLLQVGTQAAGNYGTTSGKSTIIPSVTKDPLRDAQQVLGLVGGILGLC--- 277

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIRPD 117
                        D R K N+ P+       LY + Y  +P   +  GV+AQ++ +++P+
Sbjct: 278 -------------DVRAKENIIPMGKKKGYPLYTFNYKGNP--QRYQGVLAQDVLRVKPE 322

Query: 118 TVVEN-NQGIKSVDYGRLFNIGQIQTKQKKNTA 149
            V  N    +  VDY +   +   + + KK  A
Sbjct: 323 AVFINAKTKLLHVDYDK-IGLRMEKMRMKKIPA 354


>gi|209523965|ref|ZP_03272517.1| hypothetical protein AmaxDRAFT_1335 [Arthrospira maxima CS-328]
 gi|209495637|gb|EDZ95940.1| hypothetical protein AmaxDRAFT_1335 [Arthrospira maxima CS-328]
          Length = 616

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 17/136 (12%), Positives = 38/136 (27%), Gaps = 28/136 (20%)

Query: 43  QNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------VANLYQYRYL 95
             +  + +  R          +N         SD R K  +         +  L   ++ 
Sbjct: 439 NGLSSSNIHTRFRLGGTNIAYINDSGDYVKGSSDIRFKTVLNENVNSLDLIKKLNVIKFK 498

Query: 96  SDP--------KNVQRIGVIAQEISKIRPDTVVENNQ-------------GIKSVDYGRL 134
            +             +IG+IAQE+ +  P+ V                     ++ Y +L
Sbjct: 499 YNKLAELHGFCDKEAKIGLIAQEVQEYYPEAVEVVKNDHTDSPEVDDKKIDYLTILYEKL 558

Query: 135 FNIGQIQTKQKKNTAQ 150
             +     ++     +
Sbjct: 559 VPLLVAGIQELSAKVE 574


>gi|49475688|ref|YP_033729.1| hypothetical protein BH09310 [Bartonella henselae str. Houston-1]
 gi|49238495|emb|CAF27726.1| hypothetical genomic island protein [Bartonella henselae str.
           Houston-1]
          Length = 351

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 43/136 (31%), Gaps = 18/136 (13%)

Query: 3   QKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
           Q    + ++  L+   T       +          +    +      +         F  
Sbjct: 222 QNNLDWDQLSKLLAAGTASAGNYGM---QTEQRTQFTPQTKLNPWQTIGNVGTILGTFAG 278

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPVANLYQYR---YLSDPKNVQRIGVIAQEISKIRPDTV 119
                       SDRR K N++       Y    Y       +  GV+AQ++ +  P+ V
Sbjct: 279 L-----------SDRRAKENIREAGQKKGYTLYEYNYKGSPERYRGVMAQDVLRSNPEAV 327

Query: 120 VENN-QGIKSVDYGRL 134
             NN  G+  VDY +L
Sbjct: 328 FYNNTTGLLHVDYDKL 343


>gi|225405792|ref|ZP_03760981.1| hypothetical protein CLOSTASPAR_05013 [Clostridium asparagiforme
           DSM 15981]
 gi|225042707|gb|EEG52953.1| hypothetical protein CLOSTASPAR_05013 [Clostridium asparagiforme
           DSM 15981]
          Length = 515

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/160 (11%), Positives = 48/160 (30%), Gaps = 20/160 (12%)

Query: 10  EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ 69
           E   L  N T     I   N      ++     +      +S         Y      + 
Sbjct: 341 EATGLKLNGTANTSTIGA-NVINCNHLEVQDALECGSGMTVSGPATFNGYMYANRISCFS 399

Query: 70  LAP-----LVSDRRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIR 115
           +         SD+R+K  ++ ++          L    Y +     + +G +AQ++ ++ 
Sbjct: 400 IYSEMAQSTWSDKRLKKGIRDISPETAREITLGLKSVSYRTKYSGTRSMGYVAQDVVELL 459

Query: 116 PDT-----VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                   + +   G  ++ Y  +  +     + ++    
Sbjct: 460 HTLGVDLPLTDRYNGYLAIQYQNMIPLLSGTDQAQQKEID 499


>gi|25152212|ref|NP_741883.1| hypothetical protein F21A10.2 [Caenorhabditis elegans]
 gi|22265847|emb|CAD44121.1| C. elegans protein F21A10.2b, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 947

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 44/131 (33%), Gaps = 20/131 (15%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------- 85
           +     GI        + + +   +   D            SD R+K N+          
Sbjct: 457 SWNKNGGILSTNGPVVIGKSEPRAQLTVDGDIYSSGRVMYPSDIRLKDNITEKGAKDALE 516

Query: 86  -VANLYQYRYLSDP----------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +  L    Y   P             +R GVIAQE++ + PD V +      +V+  R+
Sbjct: 517 NLQKLRIVDYFYKPEVASKWGLTEDQRKRTGVIAQELAAVLPDAVKDLGD-YLTVNESRV 575

Query: 135 FNIGQIQTKQK 145
           F    + T++ 
Sbjct: 576 FYETVLATQEL 586


>gi|25152210|ref|NP_741884.1| hypothetical protein F21A10.2 [Caenorhabditis elegans]
 gi|5824465|emb|CAA16508.2| C. elegans protein F21A10.2a, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 898

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 44/131 (33%), Gaps = 20/131 (15%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------- 85
           +     GI        + + +   +   D            SD R+K N+          
Sbjct: 408 SWNKNGGILSTNGPVVIGKSEPRAQLTVDGDIYSSGRVMYPSDIRLKDNITEKGAKDALE 467

Query: 86  -VANLYQYRYLSDP----------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +  L    Y   P             +R GVIAQE++ + PD V +      +V+  R+
Sbjct: 468 NLQKLRIVDYFYKPEVASKWGLTEDQRKRTGVIAQELAAVLPDAVKDLGD-YLTVNESRV 526

Query: 135 FNIGQIQTKQK 145
           F    + T++ 
Sbjct: 527 FYETVLATQEL 537


>gi|3335632|gb|AAC27317.1| large tail fiber subunit gp37 [Enterobacteria phage RB27]
          Length = 305

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 37/92 (40%), Gaps = 17/92 (18%)

Query: 70  LAPLVSDRRMKCNV-------KPVANLYQYRYL-----SDPKNVQR---IGVIAQEISKI 114
              + SD R+K ++       + ++ +  Y Y+      +  N +     G+IAQE+  I
Sbjct: 190 DVYVRSDIRVKKDLVKFENASEKLSKINGYTYMQKRGLDEEGNQKWEPNAGLIAQEVQAI 249

Query: 115 RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
            P+ V  +  G  +  + Y  +  +      +
Sbjct: 250 LPELVEGDPDGERLLRLFYNGVIGLNTAAINE 281


>gi|257453322|ref|ZP_05618621.1| hypothetical protein F3_09692 [Fusobacterium sp. 3_1_5R]
 gi|317059853|ref|ZP_07924338.1| predicted protein [Fusobacterium sp. 3_1_5R]
 gi|313685529|gb|EFS22364.1| predicted protein [Fusobacterium sp. 3_1_5R]
          Length = 66

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 96  SDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                 +  GVIAQE+ KI P  V   NQG KSVDY  L  +     K      +
Sbjct: 2   WKKNGKKTAGVIAQEVEKILPQAVQ--NQGYKSVDYNALVGLCIEINKALLERIE 54


>gi|32566568|ref|NP_509709.2| hypothetical protein F21A10.2 [Caenorhabditis elegans]
 gi|22265848|emb|CAD44122.1| C. elegans protein F21A10.2c, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
 gi|22265862|emb|CAD44135.1| C. elegans protein F21A10.2c, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 949

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 44/131 (33%), Gaps = 20/131 (15%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------- 85
           +     GI        + + +   +   D            SD R+K N+          
Sbjct: 459 SWNKNGGILSTNGPVVIGKSEPRAQLTVDGDIYSSGRVMYPSDIRLKDNITEKGAKDALE 518

Query: 86  -VANLYQYRYLSDP----------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +  L    Y   P             +R GVIAQE++ + PD V +      +V+  R+
Sbjct: 519 NLQKLRIVDYFYKPEVASKWGLTEDQRKRTGVIAQELAAVLPDAVKDLGD-YLTVNESRV 577

Query: 135 FNIGQIQTKQK 145
           F    + T++ 
Sbjct: 578 FYETVLATQEL 588


>gi|302144754|emb|CBW44371.1| C. elegans protein F21A10.2d, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 944

 Score = 53.5 bits (127), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 44/131 (33%), Gaps = 20/131 (15%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------- 85
           +     GI        + + +   +   D            SD R+K N+          
Sbjct: 454 SWNKNGGILSTNGPVVIGKSEPRAQLTVDGDIYSSGRVMYPSDIRLKDNITEKGAKDALE 513

Query: 86  -VANLYQYRYLSDP----------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +  L    Y   P             +R GVIAQE++ + PD V +      +V+  R+
Sbjct: 514 NLQKLRIVDYFYKPEVASKWGLTEDQRKRTGVIAQELAAVLPDAVKDLGD-YLTVNESRV 572

Query: 135 FNIGQIQTKQK 145
           F    + T++ 
Sbjct: 573 FYETVLATQEL 583


>gi|310722318|ref|YP_003969142.1| short tail fibers protein [Aeromonas phage phiAS4]
 gi|306021161|gb|ADM79696.1| short tail fibers protein [Aeromonas phage phiAS4]
          Length = 465

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 40/123 (32%), Gaps = 13/123 (10%)

Query: 41  IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA------------- 87
             +    +            + A N+      +  D R+K +++P+              
Sbjct: 337 TTRTNDVDTTIATLRPGGHLWLAGNIDINDMYVRCDTRLKTDIQPIKDALVKIDSLDAGI 396

Query: 88  NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKN 147
                    +    +  G+ AQ++ K+ P+ V   + G  +V    L  +     K+ K+
Sbjct: 397 YTKHKSLTDNTVIGKEAGIFAQQLQKVLPEGVKTLDDGTLTVSPMSLIALLIEANKELKS 456

Query: 148 TAQ 150
             +
Sbjct: 457 RLE 459


>gi|268578415|ref|XP_002644190.1| Hypothetical protein CBG17173 [Caenorhabditis briggsae]
 gi|187025955|emb|CAP34948.1| hypothetical protein CBG_17173 [Caenorhabditis briggsae AF16]
          Length = 863

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 45/131 (34%), Gaps = 20/131 (15%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------- 85
           +     G+        + + +   +   D            SD R+K N+          
Sbjct: 375 SWNKNGGVLSTTGPVVVGKSEPRAQLTVDGDIYSSGRVMCPSDIRLKDNITEKEAKEALE 434

Query: 86  -VANLYQYRYLSDP----------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +  L    Y   P             +R GVIAQE++++ PD V +      +V+  R+
Sbjct: 435 NLQKLRIVDYFYKPEVADKWGLSEDQRKRTGVIAQELAEVIPDAVKDLGD-YLTVNESRV 493

Query: 135 FNIGQIQTKQK 145
           F    + T++ 
Sbjct: 494 FYETVLATQEL 504


>gi|50952803|gb|AAT90328.1| klebicin D phage-associated protein [Klebsiella oxytoca]
          Length = 377

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 39/122 (31%), Gaps = 19/122 (15%)

Query: 40  GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL-----YQYRY 94
           G+       Q           Y             SD RMK +++ + N          Y
Sbjct: 241 GLHVANGGAQGWYEFRNDGHAY-----TNGAWNSSSDARMKTDIEKIDNALDRLDRIGGY 295

Query: 95  LSDPKNVQRIGVIAQEISKIRPDTVVEN----NQGI-----KSVDYGRLFNIGQIQTKQK 145
               +     GVIAQE+  + P  V +     N G      ++V+   +  +     +++
Sbjct: 296 TYLKQGKPEAGVIAQEVETVLPQAVTQTALTLNDGSVLEDARAVNINGVVALLVEALREE 355

Query: 146 KN 147
           K 
Sbjct: 356 KQ 357


>gi|149371909|ref|ZP_01891228.1| putative phage tail protein [unidentified eubacterium SCB49]
 gi|149355049|gb|EDM43610.1| putative phage tail protein [unidentified eubacterium SCB49]
          Length = 412

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/188 (12%), Positives = 47/188 (25%), Gaps = 39/188 (20%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQ-----NQLSERKEG 56
                 ++               ++L   T    I  +                     G
Sbjct: 200 SNTSNIYNSFEGATDGTYSGVFGVALTTGTGGIGITGSTNDWQNIGVVGSRFDSGGFDLG 259

Query: 57  KKEFYDAVNMGYQLAPLVSDRRMKCNVK-------PVANLYQYRYLSD--------PKNV 101
               +             SD+R+K ++         + ++    Y  D            
Sbjct: 260 YGGLFINDLGYTGGFWSTSDKRLKKDINNISNALATIKSIKPVSYHFDIQKYPDMGMNTN 319

Query: 102 QRIGVIAQEISKIRPDTVVEN-------------------NQGIKSVDYGRLFNIGQIQT 142
              G IAQE+  + P+ V E                     +   +VDY R+  I     
Sbjct: 320 LEYGFIAQELKNVLPNVVKEKMIPIKGARKSEINNNEPLKKELFLTVDYTRIIPILTQGI 379

Query: 143 KQKKNTAQ 150
           K+++   +
Sbjct: 380 KEQQEIIE 387


>gi|302144755|emb|CBW44372.1| C. elegans protein F21A10.2e, partially confirmed by transcript
           evidence [Caenorhabditis elegans]
          Length = 1009

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 44/131 (33%), Gaps = 20/131 (15%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------- 85
           +     GI        + + +   +   D            SD R+K N+          
Sbjct: 519 SWNKNGGILSTNGPVVIGKSEPRAQLTVDGDIYSSGRVMYPSDIRLKDNITEKGAKDALE 578

Query: 86  -VANLYQYRYLSDP----------KNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRL 134
            +  L    Y   P             +R GVIAQE++ + PD V +      +V+  R+
Sbjct: 579 NLQKLRIVDYFYKPEVASKWGLTEDQRKRTGVIAQELAAVLPDAVKDLGD-YLTVNESRV 637

Query: 135 FNIGQIQTKQK 145
           F    + T++ 
Sbjct: 638 FYETVLATQEL 648


>gi|114328216|ref|YP_745373.1| hypothetical protein GbCGDNIH1_1552 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316390|gb|ABI62450.1| hypothetical exported protein [Granulibacter bethesdensis CGDNIH1]
          Length = 548

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 43/127 (33%), Gaps = 13/127 (10%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQL-APLV 74
              ++     +  +    A       + N      +    G +      + G  +     
Sbjct: 348 NGCSMTPSGFNAYSAPGPAAAFGTNGSNNQIIAFSAGTSSGVQWIGSIGSNGSSVQYNTT 407

Query: 75  SDRRMKCNVKPVA-----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           SD R+K ++  +            ++  + ++S P      GVIA E+  + P+ V   +
Sbjct: 408 SDYRLKTSITDLDQSAAAEKILNIHIKNFAFISHPD-RIVTGVIAHELQAVIPEAVTGEH 466

Query: 124 QGIKSVD 130
            G + VD
Sbjct: 467 DGTRHVD 473


>gi|50846093|gb|AAT85003.1| klebicin C phage associated protein [Klebsiella pneumoniae]
          Length = 380

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 42/127 (33%), Gaps = 23/127 (18%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------L 89
            + G+       Q           Y             SD RMK  V+ + N       +
Sbjct: 240 HFLGLHVANGGAQGWYEFRNDGHAY-----TNGAWNSSSDARMKTQVEKIDNALEKLDCI 294

Query: 90  YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN----QGI-----KSVDYGRLFNIGQI 140
             Y Y    + V   GVIAQE+ ++ P  V +       G      +S++   +  +   
Sbjct: 295 SGYTY--LKQGVTEAGVIAQELEEVLPQAVSKTELTLNDGSVLKDARSININGVVALLIE 352

Query: 141 QTKQKKN 147
             K+++ 
Sbjct: 353 ALKEERQ 359


>gi|320186441|gb|EFW61170.1| Phage tail fiber protein [Shigella flexneri CDC 796-83]
          Length = 109

 Score = 53.2 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 40/104 (38%), Gaps = 17/104 (16%)

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEI 111
             N  +    + SD+R K N+  +             LY+ +Y +D      +G+IAQ+ 
Sbjct: 2   TGNGSFNDIQIRSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSAD-GWQTSVGLIAQDA 60

Query: 112 SKIRPDTVVENNQ-----GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            K  P+ V E+           ++Y  +  +     K  ++  +
Sbjct: 61  QKALPELVTEDADVISGEKRLRLNYNGIIALLVEGFKTLRHEIK 104


>gi|300920084|ref|ZP_07136541.1| hypothetical protein HMPREF9540_03761 [Escherichia coli MS 115-1]
 gi|300412903|gb|EFJ96213.1| hypothetical protein HMPREF9540_03761 [Escherichia coli MS 115-1]
          Length = 1027

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 35/102 (34%), Gaps = 16/102 (15%)

Query: 60   FYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPK--------NVQRI 104
            F              SD+R+K N + + N       L  Y Y              V+  
Sbjct: 916  FLGNGTANAIQWVSTSDKRLKSNFEEIENAVDKVEKLTGYVYDKKSDLVKTEYSFEVREA 975

Query: 105  GVIAQEISKIRPDTVVE-NNQGIKSVDYGRLFNIGQIQTKQK 145
            G+IAQE+ ++ P+ V       I  V+   +  +     K+ 
Sbjct: 976  GIIAQELKEVLPEAVSSFGPDEILGVNSAAVNALLVNAIKEL 1017


>gi|300778631|ref|ZP_07088489.1| hypothetical protein HMPREF0204_14350 [Chryseobacterium gleum ATCC
           35910]
 gi|300504141|gb|EFK35281.1| hypothetical protein HMPREF0204_14350 [Chryseobacterium gleum ATCC
           35910]
          Length = 536

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 42/148 (28%), Gaps = 25/148 (16%)

Query: 28  NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA 87
           +    +                            + +          SD R+K  VK + 
Sbjct: 367 SGYNTLNGSVTQIYLGAEGFKYSYNGSTKVTIDGNGLVSAAGGFVNTSDMRLKTQVKEIG 426

Query: 88  N-------LYQYRY---------LSDP------KNVQRIGVIAQEISKIRPDTVVENNQG 125
                   L   +Y            P      K   +IG +AQ++ K+ P+ V +    
Sbjct: 427 YGLSTIMALQPKQYELSANNQIKNGKPAVDPGQKTQHKIGFLAQDLYKVVPEAVYKPKDD 486

Query: 126 IK---SVDYGRLFNIGQIQTKQKKNTAQ 150
            K   +VDY  L        ++++   +
Sbjct: 487 TKEAWAVDYASLVPALTKAIQEQQAEIE 514


>gi|240851418|ref|YP_002972497.1| putative phage related protein [Bartonella grahamii as4aup]
 gi|240268541|gb|ACS52129.1| putative phage related protein [Bartonella grahamii as4aup]
          Length = 379

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 51/151 (33%), Gaps = 22/151 (14%)

Query: 4   KQQAFHEILSLMQ-NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
             Q ++ + SL+Q          + +  +   P       ++  Q               
Sbjct: 221 DNQDWNRLQSLLQIGTQAAGNYGTTSGKSTTMPSVTKDPLRDAQQVLGLVGGILGLC--- 277

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPVANLYQY---RYLSDPKNVQRIGVIAQEISKIRPDTV 119
                        D R K N+ PV     Y    +       +  GV+AQ++ +++P+ V
Sbjct: 278 -------------DVRAKENIIPVGQKKGYPLYTFNYKGNPQRYQGVMAQDVLRVKPEAV 324

Query: 120 VEN-NQGIKSVDYGRLFNIGQIQTKQKKNTA 149
             N    +  VDYG+   +   + K +K  A
Sbjct: 325 YVNAKTKLLHVDYGK-IGLKMEKMKGEKIPA 354


>gi|332520394|ref|ZP_08396856.1| hypothetical protein LacalDRAFT_1469 [Lacinutrix algicola 5H-3-7-4]
 gi|332043747|gb|EGI79942.1| hypothetical protein LacalDRAFT_1469 [Lacinutrix algicola 5H-3-7-4]
          Length = 485

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 51/160 (31%), Gaps = 19/160 (11%)

Query: 10  EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ 69
              +L  N +        +N        +   A              +    + +     
Sbjct: 295 GTNALYSNTSGYNNTAVGSNALDNVTTGHNNTAIGYLAKVPFGNGSNQVRVGNTLIAYAG 354

Query: 70  L---APLVSDRRMKCNVKP-------VANLYQYRY--LSDPKNVQRIGVIAQEISKIR-- 115
           +     + SD+R K  ++        +  L    Y   +D  N    G IAQE+ +    
Sbjct: 355 VQVAWDVTSDKRWKNTIEDSNLGLDFINTLRPVSYFRNNDKTNRIEYGFIAQELKQALQS 414

Query: 116 -----PDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                   V E+++G+ SV Y  LF+      +Q+ +  +
Sbjct: 415 SGVKSKSIVSEDSEGMLSVRYNDLFSPIVKAIQQQNDEIE 454


>gi|304373813|ref|YP_003858558.1| gp36 small distal tail fiber subunit [Enterobacteria phage RB16]
 gi|299829769|gb|ADJ55562.1| gp36 small distal tail fiber subunit [Enterobacteria phage RB16]
          Length = 715

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 45/125 (36%), Gaps = 16/125 (12%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV-------ANLYQYRY 94
            + I+Q+      +G  +F  + N  +    + SD R+K N+  +         L    Y
Sbjct: 586 VRLIHQSGAYYHFDGSGQFTASGNGNFNDVYIRSDERLKSNLSKIESALDKVDLLEGVIY 645

Query: 95  LSDPKNV-----QRIGVIAQEISKIRPDTVVENNQ----GIKSVDYGRLFNIGQIQTKQK 145
                       +  G+IAQ++ ++ P+ V          I +V    +  +     K+ 
Sbjct: 646 DKADHVGGEPTSREAGLIAQQLREVLPEAVKTGEDTERNEILTVSPTAVIALLVNAIKEL 705

Query: 146 KNTAQ 150
           +   +
Sbjct: 706 REEIR 710


>gi|327403665|ref|YP_004344503.1| Collagen triple helix repeat-containing protein [Fluviicola taffensis
            DSM 16823]
 gi|327319173|gb|AEA43665.1| Collagen triple helix repeat-containing protein [Fluviicola taffensis
            DSM 16823]
          Length = 1163

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 45/158 (28%), Gaps = 15/158 (9%)

Query: 6    QAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVN 65
             A +    +    +   +       T    I    I  +              + +  + 
Sbjct: 851  SAANIKSYIDNGGSFYSIHNDPTFITAAQDIPAINIDNSNNVAIKKYYAASALDVWGTIL 910

Query: 66   MGYQLAPLVSDRRMKCNVKPVA----------NLYQYRYLSDPKN---VQRIGVIAQEIS 112
                     SD  +K N++ +               + + S         + G IAQE  
Sbjct: 911  QNGSSVT--SDSTLKHNIQDLDINADSLLNLLRPRTFEWNSVQDTFMLGTQYGFIAQEFE 968

Query: 113  KIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             + P+ V   N  IK +  G LF I  +  K +K    
Sbjct: 969  TVLPELVKAGNDDIKHISSGGLFPILVLGYKNQKAQID 1006


>gi|332343034|gb|AEE56368.1| L-shaped tail fiber protein [Escherichia coli UMNK88]
          Length = 841

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 42/128 (32%), Gaps = 26/128 (20%)

Query: 48  NQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKN 100
             + +  +G +      ++       +SDR +K N++ + +       +  Y Y      
Sbjct: 678 FYVQKVADGSRVLRVNGSVTCTTVNQLSDRDLKDNIQVIGDATEAIRKMNGYTYTLKENG 737

Query: 101 VQRIGVIAQEISKIRPDTVV-------------------ENNQGIKSVDYGRLFNIGQIQ 141
           +   GVIAQE+ +  P+ V                           +VDY  +  +    
Sbjct: 738 LPYAGVIAQEVMEALPEAVGSFTHYGEALQGPTIDGNELREETRYLNVDYAAVTGLLVQV 797

Query: 142 TKQKKNTA 149
            ++  N  
Sbjct: 798 ARETDNRV 805


>gi|209526480|ref|ZP_03275007.1| hypothetical protein AmaxDRAFT_3831 [Arthrospira maxima CS-328]
 gi|209528002|ref|ZP_03276484.1| hypothetical protein AmaxDRAFT_5310 [Arthrospira maxima CS-328]
 gi|209491559|gb|EDZ91932.1| hypothetical protein AmaxDRAFT_5310 [Arthrospira maxima CS-328]
 gi|209493115|gb|EDZ93443.1| hypothetical protein AmaxDRAFT_3831 [Arthrospira maxima CS-328]
          Length = 967

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 37/131 (28%), Gaps = 28/131 (21%)

Query: 43  QNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------VANLYQYRYL 95
             +  + +  R          +N         SD R K  +         +  L   ++ 
Sbjct: 776 NGLSSSNIHTRFRLGGTNIAYINDSGDYVKGSSDIRFKTVLNENVNSLDLIKKLNVIKFK 835

Query: 96  SDP--------KNVQRIGVIAQEISKIRPDTVVENNQ-------------GIKSVDYGRL 134
            +             +IG+IAQE+ +  P+ V                     ++ Y +L
Sbjct: 836 YNKLAELHGFCDKEAKIGLIAQEVQEYYPEAVEVVKNDHTDSPEVDDKKIDYLTILYEKL 895

Query: 135 FNIGQIQTKQK 145
             +     ++ 
Sbjct: 896 VPLLVAGIQEL 906


>gi|310005873|gb|ADP00258.1| predicted protein [Cyanophage Syn26]
          Length = 576

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/150 (10%), Positives = 37/150 (24%), Gaps = 36/150 (24%)

Query: 30  PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV--- 86
            +      ++  +    Q  +  R           +         SD R+K N   +   
Sbjct: 410 GSTSTGSVFSSGSATNTQTHIIFRNGNGDVGTIQTSGSSTAYNTSSDYRLKENAVAISDG 469

Query: 87  ----ANLYQYRYLSDPK-NVQRIGVIAQEISKIRPDTVVENNQG---------------- 125
                 L  YR+      +    G  A E++ + P+ +                      
Sbjct: 470 ITRLKTLKPYRFNFKADADTTVDGFFAHEVTAV-PEAISGTKDETKDILYTEEDTIPSGK 528

Query: 126 -----------IKSVDYGRLFNIGQIQTKQ 144
                       + +D  ++  +     ++
Sbjct: 529 KVGDVKQVDPVYQGIDQSKIVPLLTAALQE 558


>gi|291514543|emb|CBK63753.1| hypothetical protein AL1_12830 [Alistipes shahii WAL 8301]
          Length = 203

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 26/76 (34%), Gaps = 13/76 (17%)

Query: 83  VKPVANLYQYRYLSDPK-------------NVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
              V  L   +Y    +              V+  G +AQE+  I P  V    +G + V
Sbjct: 112 TNMVLKLNPVKYHWRDESEYERFNIRPVQSGVEEYGFLAQELEAIIPGAVAMTEEGDRLV 171

Query: 130 DYGRLFNIGQIQTKQK 145
           +Y  L  I     ++ 
Sbjct: 172 NYSALIPILTGAIQEL 187


>gi|3676527|gb|AAC62007.1| distal tail fiber large subunit gp37 [Enterobacteria phage Ac3]
          Length = 1103

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 37/92 (40%), Gaps = 17/92 (18%)

Query: 70   LAPLVSDRRMKCNV-------KPVANLYQYRY-----LSDPKNVQR---IGVIAQEISKI 114
               + SD R+K N+       + ++ +  Y Y       +  N +     G+IAQE+  I
Sbjct: 988  DVYVRSDIRVKKNLVKFENASEKLSKINGYTYMQKRGTDEEGNQKWEPNAGLIAQEVQDI 1047

Query: 115  RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
             P+ V  +  G  +  ++Y  +  +      +
Sbjct: 1048 LPEFVEGDPDGEALLRLNYNGVIGLNTAAINE 1079


>gi|167391385|ref|XP_001739752.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165896455|gb|EDR23863.1| hypothetical protein EDI_016550 [Entamoeba dispar SAW760]
          Length = 492

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 34/86 (39%), Gaps = 10/86 (11%)

Query: 69  QLAPLVSDRRMKCNVKPVANL---------YQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                 SD++ K  ++ +            Y + Y +D  N +  G +AQE+ +I P+TV
Sbjct: 139 AGFFQRSDQKNKNEIQKITGALEQLKNVVGYSFVYKNDENNQKY-GFMAQELQEIYPNTV 197

Query: 120 VENNQGIKSVDYGRLFNIGQIQTKQK 145
                G  S+D   L        K+ 
Sbjct: 198 KVLPDGTLSIDTVALLPYIVSSLKEL 223


>gi|313157854|gb|EFR57262.1| conserved hypothetical protein [Alistipes sp. HGB5]
          Length = 202

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 26/76 (34%), Gaps = 13/76 (17%)

Query: 83  VKPVANLYQYRYLSDPK-------------NVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
              V  L   +Y    +              V+  G +AQE+  I P  V    +G + V
Sbjct: 111 TNMVLKLNPVKYHWRDESEYERFNIRPVQSGVEEYGFLAQELEAIIPGAVAMTEEGDRLV 170

Query: 130 DYGRLFNIGQIQTKQK 145
           +Y  L  I     ++ 
Sbjct: 171 NYSALIPILTGAIQEL 186


>gi|308480796|ref|XP_003102604.1| hypothetical protein CRE_03188 [Caenorhabditis remanei]
 gi|308261038|gb|EFP04991.1| hypothetical protein CRE_03188 [Caenorhabditis remanei]
          Length = 567

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 20/91 (21%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDP----------KNVQRIGVIAQEISKI 114
            SD R+K N+         + +  L    Y   P             +R GVIAQE+++I
Sbjct: 91  PSDIRLKDNITGKEAKEALENLQKLRIVDYFYKPEVAEKWGLSEDQRKRTGVIAQELAEI 150

Query: 115 RPDTVVENNQGIKSVDYGRLFNIGQIQTKQK 145
            PD V +      +V+  R+F    + T++ 
Sbjct: 151 IPDAVRDIGD-YLTVNESRVFYETVLATQEL 180


>gi|163786020|ref|ZP_02180468.1| cell wall surface anchor family protein [Flavobacteriales bacterium
           ALC-1]
 gi|159877880|gb|EDP71936.1| cell wall surface anchor family protein [Flavobacteriales bacterium
           ALC-1]
          Length = 503

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/105 (15%), Positives = 33/105 (31%), Gaps = 23/105 (21%)

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRI--GVIAQEISKIRPDTV 119
                 SDRR K N+  +         +    +     N   +  G+IAQ++  + P+ V
Sbjct: 376 NGTINTSDRREKKNIHDLGYGLNEVLQMKPISFNWKNTNNPDLKLGLIAQDLQALIPEVV 435

Query: 120 --------------VENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                          +       V Y  L  +     +++++   
Sbjct: 436 KSHAWEADEVTGQLTKKELDRLGVYYSDLVPVLIKAIQEQQSIID 480


>gi|319409246|emb|CBI82890.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 374

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 48/139 (34%), Gaps = 21/139 (15%)

Query: 1   MDQKQQAFHEILSLMQ-NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKE 59
           M+Q  QA++ +  L++   T      +    +   P                +       
Sbjct: 218 MEQDNQAWNRLEQLLKVGTTAAGNYGTQTGQSVTVPS-----VTKDPLRDAQQVLGLIGG 272

Query: 60  FYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQY---RYLSDPKNVQRIGVIAQEISKIRP 116
                          SD R+K N+  V     Y    +       +  GV+AQ++ +++P
Sbjct: 273 IMGL-----------SDARVKDNIVSVGEKNGYPLYEFNYKGDPQRYRGVMAQDLVRLKP 321

Query: 117 DTVVENN-QGIKSVDYGRL 134
           D V  ++   +  VDY ++
Sbjct: 322 DAVHMDDKTQLLYVDYDKI 340


>gi|293409525|ref|ZP_06653101.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291469993|gb|EFF12477.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 160

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 35/112 (31%), Gaps = 26/112 (23%)

Query: 59  EFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEI 111
            F     +        SDR +K ++  +++       +  Y Y      +   GVIAQE+
Sbjct: 1   MFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLKENGMPYAGVIAQEV 60

Query: 112 SKIRPDTVV-------------------ENNQGIKSVDYGRLFNIGQIQTKQ 144
            +  P+ V                           +VDY  +  +     ++
Sbjct: 61  MEAIPEAVGSFTHYGEELQGPTVDGNELREETRYLNVDYSAVTGLLVQVARE 112


>gi|42523973|ref|NP_969353.1| hypothetical protein Bd2548 [Bdellovibrio bacteriovorus HD100]
 gi|39576181|emb|CAE80346.1| hypothetical protein Bd2548 [Bdellovibrio bacteriovorus HD100]
          Length = 1660

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 39/146 (26%), Gaps = 24/146 (16%)

Query: 19   TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
            +   + I +  PT    +             +          Y           + SD R
Sbjct: 1478 SAGNVGIGVTGPTSKLQVAGNITPDITASKNIGSSTLRWNNIY-----LSNAPDVSSDAR 1532

Query: 79   MKCNVKP-------VANLYQYRYLSDPKN---VQRIGVIAQEISKIRPDT--------VV 120
            +K NVK        V +L    +    +N    +  GVIAQE                V 
Sbjct: 1533 LKKNVKDSDLGLDFVNSLRPVSWTWKDENQGATEHYGVIAQEAELAIAKAKGEPSDVIVT 1592

Query: 121  ENNQ-GIKSVDYGRLFNIGQIQTKQK 145
             N      SV Y  L        ++ 
Sbjct: 1593 HNEDSDSYSVRYTELIAPIIKAVQEL 1618


>gi|270265110|ref|ZP_06193373.1| hypothetical protein SOD_k01480 [Serratia odorifera 4Rx13]
 gi|270041044|gb|EFA14145.1| hypothetical protein SOD_k01480 [Serratia odorifera 4Rx13]
          Length = 377

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 34/97 (35%), Gaps = 18/97 (18%)

Query: 67  GYQLAPLVSDRRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                   SD RMK  +  +         +  Y Y    + V   GVIAQE+  + P +V
Sbjct: 263 ANGGWNSSSDIRMKTEIVKIDGALDKLGKISGYTY--LKQGVPEAGVIAQEVESVLPQSV 320

Query: 120 VENN----QGI-----KSVDYGRLFNIGQIQTKQKKN 147
                    G      + ++   +  +     K++++
Sbjct: 321 TTTELKLNDGSVLQDARGININGVVALLIEALKEERD 357


>gi|323942219|gb|EGB38391.1| prophage tail fibre [Escherichia coli E482]
          Length = 1040

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 40/121 (33%), Gaps = 26/121 (21%)

Query: 50  LSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQ 102
            +++    + F     +        SDR +K +++ +++       +  Y Y      + 
Sbjct: 872 YAQKTSAGQLFDVNGAINCTTLNQSSDRDLKDDIRVISDATKAIRKMNGYTYTLKENGMP 931

Query: 103 RIGVIAQEISKIRPDTVV-------------------ENNQGIKSVDYGRLFNIGQIQTK 143
             GVIAQE+ +  P+ V                           +VDY  +  +     +
Sbjct: 932 YAGVIAQEVMEAIPEAVGSFTHYGEELQGPTVDGNELREETRYLNVDYSAVTGLLVQVAR 991

Query: 144 Q 144
           +
Sbjct: 992 E 992


>gi|327409569|ref|YP_004346989.1| hypothetical protein LAU_0021 [Lausannevirus]
 gi|326784743|gb|AEA06877.1| conserved hypothetical protein [Lausannevirus]
          Length = 383

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 40/140 (28%), Gaps = 8/140 (5%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
               +     I   + T     +            L                   +  + 
Sbjct: 237 TAGTSGSNRIILGASTTGTTNNEMTIAPTITRWRSLGLSSAAAANTLQIDPATGVITQVA 296

Query: 75  SDRRMKCNVK-------PVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI- 126
           S +R K N++        +  L    Y       +  G+IA+E  +I P+ V  + +G  
Sbjct: 297 SSKRFKDNIRNLEVDTEKLHQLSLKTYNYKEDKKEDYGLIAEEAYEILPEIVTLDAEGKP 356

Query: 127 KSVDYGRLFNIGQIQTKQKK 146
             + +  L  +   + +  +
Sbjct: 357 HGIRHTTLAMLLLAEVQSLR 376


>gi|163867718|ref|YP_001608920.1| hypothetical protein Btr_0470 [Bartonella tribocorum CIP 105476]
 gi|161017367|emb|CAK00925.1| hypothetical protein BT_0470 [Bartonella tribocorum CIP 105476]
          Length = 351

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 36/109 (33%), Gaps = 4/109 (3%)

Query: 30  PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL 89
               A     G           + K    E    V         +SD R K N+      
Sbjct: 235 AAGGAVAGNYGTRTGQMTTLTPQPKPNPWEIVGNVGTILGTFAGLSDTRAKENITEAGQR 294

Query: 90  YQYR---YLSDPKNVQRIGVIAQEISKIRPDTVVENN-QGIKSVDYGRL 134
             Y    Y       +  GV+AQ++ K +P+ V  NN  G   VDY +L
Sbjct: 295 NGYTLYEYNYKGYPERYRGVMAQDVLKSKPEAVFYNNATGFLHVDYSKL 343


>gi|319405790|emb|CBI79416.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 343

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 40/104 (38%), Gaps = 6/104 (5%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY--QLAPLVSDRRMKCNVKPVANLYQ--- 91
              G A   Y  Q S  ++ +  +    N G        +SD R K N+  V        
Sbjct: 232 SAGGAAAGGYGTQTSLTQQKQNPWKILGNAGSILGNWAGLSDVRAKENIIAVGQKNGHKL 291

Query: 92  YRYLSDPKNVQRIGVIAQEISKIRPDTVVEN-NQGIKSVDYGRL 134
           Y Y       +  GVIAQE+ +  P+ V  N   G   VDY +L
Sbjct: 292 YDYNYKGYPERYRGVIAQEVFQANPEAVFLNTATGFLHVDYNKL 335


>gi|326633016|ref|YP_004306605.1| hypothetical protein SPC35_0122 [Enterobacteria phage SPC35]
 gi|321272210|gb|ADW80102.1| hypothetical protein SPC35_0122 [Enterobacteria phage SPC35]
          Length = 695

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 34/111 (30%), Gaps = 19/111 (17%)

Query: 59  EFYDAVNMGYQLAPLVSDRRMKCNVKPVANLY-------QYRY------LSDPKN--VQR 103
            F    N         SD RMK N+K + N          Y Y        +        
Sbjct: 566 HFDSGGNAVAGQWISSSDIRMKANLKEIENARDKVKSLVGYTYYKRNTLKEEKDTVYSTE 625

Query: 104 IGVIAQEISKIRPDTVVE----NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            GVIAQ++  + P+ V +        +  V +  +  +      +     +
Sbjct: 626 AGVIAQDVQSVLPEAVYKIEPQKEDSMLGVSHAGVNALLVNAFNELNEVVE 676


>gi|312088535|ref|XP_003145899.1| hypothetical protein LOAG_10325 [Loa loa]
 gi|307758937|gb|EFO18171.1| hypothetical protein LOAG_10325 [Loa loa]
          Length = 873

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 43/128 (33%), Gaps = 20/128 (15%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA--------- 87
           + + +  N     +   +               +    SDRRMK  +  V          
Sbjct: 336 NGSTLYYNSGSVAIGTDRAVAPLTVGGDIYCSGVVHRPSDRRMKEQIHEVDTKSALSHLA 395

Query: 88  NLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
            +    Y   P+          N  R+GVIAQE+++I PD V +N      VD  R+F  
Sbjct: 396 QIRVVGYSYKPEIALKWGLSEENRHRVGVIAQELAEILPDAVTDNGD-FLQVDDSRIFYE 454

Query: 138 GQIQTKQK 145
                 + 
Sbjct: 455 TVAAATEL 462


>gi|300902064|ref|ZP_07120080.1| hypothetical protein HMPREF9536_00268 [Escherichia coli MS 84-1]
 gi|300405828|gb|EFJ89366.1| hypothetical protein HMPREF9536_00268 [Escherichia coli MS 84-1]
          Length = 317

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 43/155 (27%), Gaps = 28/155 (18%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +    L    +   + I +   +    +   G +                    +  +  
Sbjct: 165 NRFALLNSGNSELPVSIRVWGSSTRQNVFEVGTSAAYLFYAQKTTDGQNLTVNGS--VNC 222

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV- 120
                 SDRR+K N++ + N       +  Y Y          GVIAQE+ +  P+ V  
Sbjct: 223 TTLNQSSDRRLKENIEIIDNATDAIRKINGYTYTLKENGAHCAGVIAQEVEEAIPEAVGS 282

Query: 121 ------------------ENNQGIKSVDYGRLFNI 137
                                    +VDY  +  +
Sbjct: 283 FIHYGEELQGPTVDGNELREETRYLNVDYAAVTGL 317


>gi|327409571|ref|YP_004346991.1| hypothetical protein LAU_0023 [Lausannevirus]
 gi|326784745|gb|AEA06879.1| conserved hypothetical protein [Lausannevirus]
          Length = 383

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 14/147 (9%), Positives = 38/147 (25%), Gaps = 8/147 (5%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
                  +     +   +       +            L                   + 
Sbjct: 234 TGATSGTSGTNRIVLGASAVGATDNEMTVAPTITQWRSLGLSSAAAANTLQINPATGVIT 293

Query: 72  PLVSDRRMKC-------NVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ 124
              S +R K        +   + +L    Y       +  G+IA++  +I P+ V  + +
Sbjct: 294 QAASSKRFKEEIQDLEVDTSKLHDLSLKTYRYKTDGKKDYGLIAEDTFEILPELVTLDAE 353

Query: 125 GI-KSVDYGRLFNIGQIQTKQKKNTAQ 150
           G    + +  L  +   + +  +   +
Sbjct: 354 GKPHGIKHLTLAMLLLAEIQNLRKELE 380


>gi|126662781|ref|ZP_01733780.1| cell wall surface anchor family protein [Flavobacteria bacterium
           BAL38]
 gi|126626160|gb|EAZ96849.1| cell wall surface anchor family protein [Flavobacteria bacterium
           BAL38]
          Length = 565

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/169 (12%), Positives = 46/169 (27%), Gaps = 34/169 (20%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM--GYQ 69
            +     +   +            + + G   N   ++ S       +            
Sbjct: 375 SNSNSGGSAVAIGSIEYFIDGTNELFFEGSGFNPMSDETSSFGNTLGKTNRRWGAVYATN 434

Query: 70  LAPLVSDRRMKCNVKPVAN-------LYQYRYLSD-----------PKNVQRIGVIAQEI 111
                SD  +K NV+P+         L    Y               K  ++IG  AQ++
Sbjct: 435 GVITTSDMNLKTNVQPLNYGLKELLKLNTITYNWKNYKLGKTTIPLEKQEKKIGFSAQQL 494

Query: 112 SKIRPDTVVEN--------------NQGIKSVDYGRLFNIGQIQTKQKK 146
            +I P+ V  +                    V+Y  +  +     ++++
Sbjct: 495 LEILPEVVQTHSWVPVNENGDYKEVKNEHLGVNYSDIIPVTVKAIQEQQ 543


>gi|238695397|ref|YP_002922590.1| gp37 long tail fiber, distal subunit [Enterobacteria phage JS10]
 gi|220029533|gb|ACL78467.1| gp37 long tail fiber, distal subunit [Enterobacteria phage JS10]
          Length = 1103

 Score = 50.5 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 17/92 (18%)

Query: 70   LAPLVSDRRMKCNV-------KPVANLYQYRY--------LSDPKNVQRIGVIAQEISKI 114
               + SD R+K ++       + ++ +  Y Y          + K     G+IAQE+  I
Sbjct: 988  DVYVRSDIRVKKDLVKFENASQKLSKINGYTYMQKRGLDEEGNQKWEPNAGLIAQEVQAI 1047

Query: 115  RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
             P+ V  +  G  +  ++Y  +  +      +
Sbjct: 1048 LPELVEGDPDGEALLRLNYNGVIGLNTAAINE 1079


>gi|13560699|gb|AAK30164.1|AF349974_1 distal tail fiber protein [Enterobacteria phage PP01]
          Length = 1109

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 17/92 (18%)

Query: 70   LAPLVSDRRMKCNV-------KPVANLYQYRY--------LSDPKNVQRIGVIAQEISKI 114
               + SD R+K ++       + ++ +  Y Y          + K     G+IAQE+  I
Sbjct: 994  DVYVRSDIRVKKDLVKFENASEKLSKINGYTYMQKRGLDEEGNQKWEPNAGLIAQEVQAI 1053

Query: 115  RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
             P+ V  +  G  +  ++Y  +  +      +
Sbjct: 1054 LPELVEGDPDGEALLRLNYNGVIGLNTAAINE 1085


>gi|268532300|ref|XP_002631278.1| C. briggsae CBR-PQN-47 protein [Caenorhabditis briggsae]
          Length = 918

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 40/129 (31%), Gaps = 20/129 (15%)

Query: 36  IDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPV 86
             +              + E  +                SD R+K  +         + +
Sbjct: 435 NGHTLCTPGNVAIGTDRQAETARLTVAGDIYCSGRVINPSDIRLKEGISEKETAEAIENL 494

Query: 87  ANLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFN 136
             L    Y    +            QR G+IAQE+  + PD V +      ++D GR+F 
Sbjct: 495 LKLRVVDYRYKDEVANVWGLDEQQRQRTGLIAQELQAVLPDAVRDIGD-YLTIDEGRVFY 553

Query: 137 IGQIQTKQK 145
              + T+Q 
Sbjct: 554 ETVMATQQL 562


>gi|323934266|gb|EGB30690.1| phage tail fiber protein [Escherichia coli E1520]
          Length = 1080

 Score = 50.5 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 17/135 (12%), Positives = 44/135 (32%), Gaps = 14/135 (10%)

Query: 30   PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV--- 86
                        ++       +   +    +    N  +    + SDRR K N++ +   
Sbjct: 940  GNSQFGFYMINNSRTANGTDANAYLQNDGTWVCGGNGSFNDVYIRSDRRSKRNIRKIERA 999

Query: 87   ----ANLYQYRYLSD--PKNVQRIGVIAQEISKIRPDTVVENNQG-----IKSVDYGRLF 135
                  +    Y      +  Q  G+IAQ++  ++P+ V  ++          ++Y  + 
Sbjct: 1000 LDKLDRIEGVLYEIQVCDRYEQSGGLIAQDVQNVQPELVTVDHNDQSGEPRLRLNYNGVI 1059

Query: 136  NIGQIQTKQKKNTAQ 150
             +     K+ +   +
Sbjct: 1060 GMLVEAVKELREEVR 1074


>gi|309364934|emb|CAP23547.2| CBR-PQN-47 protein [Caenorhabditis briggsae AF16]
          Length = 925

 Score = 50.5 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 40/129 (31%), Gaps = 20/129 (15%)

Query: 36  IDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPV 86
             +              + E  +                SD R+K  +         + +
Sbjct: 425 NGHTLCTPGNVAIGTDRQAETARLTVAGDIYCSGRVINPSDIRLKEGISEKETAEAIENL 484

Query: 87  ANLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFN 136
             L    Y    +            QR G+IAQE+  + PD V +      ++D GR+F 
Sbjct: 485 LKLRVVDYRYKDEVANVWGLDEQQRQRTGLIAQELQAVLPDAVRDIGD-YLTIDEGRVFY 543

Query: 137 IGQIQTKQK 145
              + T+Q 
Sbjct: 544 ETVMATQQL 552


>gi|218510551|ref|ZP_03508429.1| hypothetical protein RetlB5_25766 [Rhizobium etli Brasil 5]
          Length = 271

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 23/58 (39%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK 58
           + ++ Q  +EI +LM    V +        T +  +D AG+    +  ++    +   
Sbjct: 189 LTERNQPLNEISALMSGSQVNQPNYVNTPTTQLPTVDQAGLINENFNQKMGIYNQQVA 246


>gi|157368780|ref|YP_001476769.1| hypothetical protein Spro_0533 [Serratia proteamaculans 568]
 gi|157320544|gb|ABV39641.1| hypothetical protein Spro_0533 [Serratia proteamaculans 568]
          Length = 378

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 33/94 (35%), Gaps = 18/94 (19%)

Query: 67  GYQLAPLVSDRRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                   SD RMK +++ +         +  Y Y    + V   GVIAQE+  + P +V
Sbjct: 263 TNGTWNSSSDIRMKTDIEKIDGALEKLGKIGGYTY--LKQGVPEAGVIAQEVENVLPQSV 320

Query: 120 VENN----QGI-----KSVDYGRLFNIGQIQTKQ 144
                    G      + ++   +  +     K+
Sbjct: 321 TTTELKLNDGSVLKDARGININGVVALLVEALKE 354


>gi|238821363|ref|YP_002925179.1| hypothetical protein PH10_gp46 [Streptococcus phage PH10]
 gi|238804945|emb|CAY56539.1| hypothetical protein [Streptococcus phage PH10]
          Length = 1137

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/137 (21%), Positives = 47/137 (34%), Gaps = 19/137 (13%)

Query: 27   LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL----VSDRRMKCN 82
              N              N     LS        +Y   +  Y L  +     SDRR+K N
Sbjct: 981  TGNGRIDGGTTGTIGLWNSGNVYLSFGGSSNDIYYSYNSTAYSLWSVINKHFSDRRLKDN 1040

Query: 83   VKPVAN----------LYQYRYLSDPKNVQR----IGVIAQEISKIRPDTVVENNQGIKS 128
            +    +            +Y +       Q+    IG+IAQE+ ++ P  V +N     +
Sbjct: 1041 IVDCKHKALDYIHQFQFKEYDWKKQEDRPQQAHTKIGLIAQEVQEVDPTLVYKNGD-TLN 1099

Query: 129  VDYGRLFNIGQIQTKQK 145
            +D  RL NI     ++ 
Sbjct: 1100 LDNLRLTNIALKAIQEL 1116


>gi|66391731|ref|YP_239256.1| gp36 small distal tail fiber subunit [Enterobacteria phage RB43]
 gi|62288819|gb|AAX78802.1| gp36 small distal tail fiber subunit [Enterobacteria phage RB43]
          Length = 742

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 36/121 (29%), Gaps = 16/121 (13%)

Query: 46  YQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRY---- 94
           Y +                +  +    + SD ++K N   + N       L    Y    
Sbjct: 616 YFDGDGSFSTSTGNITAGNSGYFNDVYIRSDEKLKSNFNKIENALDKVELLNGLTYDKAS 675

Query: 95  -LSDPKNVQRIGVIAQEISKIRPDTVVENNQ----GIKSVDYGRLFNIGQIQTKQKKNTA 149
            +      +  G+IAQE+ K+ P+ V          +  +       +     K+ +   
Sbjct: 676 YIGGETVKREAGLIAQELQKVLPEAVSVGKDTKENEVLVISPTATIALLVEAIKELREEV 735

Query: 150 Q 150
           +
Sbjct: 736 R 736


>gi|20140797|sp|Q9G0B5|VG37_BPAR1 RecName: Full=Long tail fiber protein p37; Short=Protein Gp37;
            AltName: Full=Receptor-recognizing protein
 gi|11095166|gb|AAG29754.1|AF208841_2 gp37 [Enterobacteria phage AR1]
          Length = 1103

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 17/92 (18%)

Query: 70   LAPLVSDRRMKCNV-------KPVANLYQYRY--------LSDPKNVQRIGVIAQEISKI 114
               + SD R+K ++       + ++ +  Y Y          + K     G+IAQE+  I
Sbjct: 988  DVYVRSDIRVKKDLVKFENASEKLSKINGYTYMQKRGLDEEGNQKWEPNAGLIAQEVQAI 1047

Query: 115  RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
             P+ V  +  G  +  ++Y  +  +      +
Sbjct: 1048 LPELVEGDPDGERLLRLNYNGVIGLNTAAINE 1079


>gi|301307488|ref|ZP_07213475.1| hypothetical protein HMPREF9347_06041 [Escherichia coli MS 124-1]
 gi|300837351|gb|EFK65111.1| hypothetical protein HMPREF9347_06041 [Escherichia coli MS 124-1]
          Length = 854

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 51/156 (32%), Gaps = 26/156 (16%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
           +QN    +LP S+         ++  +  +      +++    + F     +        
Sbjct: 651 LQNSGNAELPFSVRVWGSSTRQNFFEVGTSAAYLFYAQKTSAGQLFDVNGAINCTTLNQS 710

Query: 75  SDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV------- 120
           SDR +K ++  +++       +  Y Y      +   GVIAQE+ +  P+ V        
Sbjct: 711 SDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPYAGVIAQEVMEAIPEAVGSFTHYGE 770

Query: 121 ------------ENNQGIKSVDYGRLFNIGQIQTKQ 144
                              +VDY  +  +     ++
Sbjct: 771 ELQGPTVDGNELREETRYLNVDYAAVTGLLVQVARE 806


>gi|188535866|ref|YP_001905926.1| Klebicin C phage associated protein [Erwinia tasmaniensis Et1/99]
 gi|188027170|emb|CAO94993.1| Klebicin C phage associated protein [Erwinia tasmaniensis Et1/99]
          Length = 380

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 35/94 (37%), Gaps = 18/94 (19%)

Query: 67  GYQLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                   SD RMK ++  +        ++  Y Y    + +   GVIAQE+ +I P +V
Sbjct: 263 TNGAWHNSSDIRMKTDITQIDGALDKLAHIGGYTY--LKQGLPEAGVIAQEVEEILPQSV 320

Query: 120 VENN----QGI-----KSVDYGRLFNIGQIQTKQ 144
                    G      +S++   +  +     K+
Sbjct: 321 TRTELKLNDGSVLKDARSININGVVALLVEALKE 354


>gi|315253976|gb|EFU33944.1| conserved hypothetical protein [Escherichia coli MS 85-1]
          Length = 849

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 51/156 (32%), Gaps = 26/156 (16%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
           +QN    +LP S+         ++  +  +      +++    + F     +        
Sbjct: 646 LQNSGNAELPFSVRVWGSSTRQNFFEVGTSAAYLFYAQKTSAGQLFDVNGAINCTTLNQS 705

Query: 75  SDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV------- 120
           SDR +K ++  +++       +  Y Y      +   GVIAQE+ +  P+ V        
Sbjct: 706 SDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPYAGVIAQEVMEAIPEAVGSFTHYGE 765

Query: 121 ------------ENNQGIKSVDYGRLFNIGQIQTKQ 144
                              +VDY  +  +     ++
Sbjct: 766 ELQGPTVDGNELREETRYLNVDYAAVTGLLVQVARE 801


>gi|291335334|gb|ADD94950.1| hypothetical protein [uncultured phage MedDCM-OCT-S01-C58]
          Length = 318

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 40/136 (29%), Gaps = 16/136 (11%)

Query: 25  ISLNNPTPIAPIDYAGIAQNIYQNQLS-ERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV 83
               N  P A  +  G       + +              ++         SDRR+K N+
Sbjct: 165 NVCFNGGPAAKFNRIGSGGTELGSVVQFHSNGSSAGRIGIISASDVSLIDASDRRLKDNI 224

Query: 84  KP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG--------IKS 128
                    +  +  +R+     +    G IAQE+ ++ P  V+ +              
Sbjct: 225 TDMPEAKSRINQIQMHRFRMISADSYEEGFIAQELKEVVPSAVMGSETDVDDEGNVEYMG 284

Query: 129 VDYGRLFNIGQIQTKQ 144
           V    L  +     ++
Sbjct: 285 VGKDMLVPLLMKGLQE 300


>gi|294493335|gb|ADE92091.1| conserved hypothetical protein [Escherichia coli IHE3034]
          Length = 346

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 45/157 (28%), Gaps = 24/157 (15%)

Query: 12  LSLMQNVTVPKLPISLN---NPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
            ++  N                +    +        ++        +   +         
Sbjct: 161 STMTLNTQGTAYSGVSTLLWGNSSRPVVYEIRDDGGLFLFYAQRNPDKTYQLEINGPCKA 220

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV-- 119
                VSDR +K N++ + N       +  Y Y      +   GVIAQE     P++V  
Sbjct: 221 TSFDQVSDRDLKENIQVIDNATERIRLMNGYTYRLKSNGMPYAGVIAQEALNAIPESVGS 280

Query: 120 ----------VENNQG--IKSVDYGRLFNIGQIQTKQ 144
                      +  +G    +VDY  +  +     ++
Sbjct: 281 TIKYKSGDNGSDGEEGERYYTVDYSGVTGLLVQVARE 317


>gi|224050599|ref|XP_002195967.1| PREDICTED: similar to Uncharacterized protein C11orf9 homolog
           [Taeniopygia guttata]
          Length = 1185

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 35/99 (35%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVK---------PVANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K +++         P++ +    Y   P         +    GVIAQE+ +I P
Sbjct: 640 PSDVRVKEDIQEVRTWKHVIPISWMRLVHYNYKPEFAATVGIDSTSETGVIAQEVKEILP 699

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           + V +                 V+  R+F       K+ 
Sbjct: 700 EAVKDTGDLVFSNGKTLENFLVVNKERIFMENVGAVKEL 738


>gi|308509976|ref|XP_003117171.1| CRE-PQN-47 protein [Caenorhabditis remanei]
 gi|308242085|gb|EFO86037.1| CRE-PQN-47 protein [Caenorhabditis remanei]
          Length = 932

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 46/148 (31%), Gaps = 24/148 (16%)

Query: 20  VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKK---EFYDAVNMGYQLAPLVSD 76
                      + +A     G      Q  +   +            +    ++    SD
Sbjct: 417 ATNPGSFDPPDSDVAWQRSGGTLYTPGQVAIGTERPADNARLTVTGDIYCSGRVIN-PSD 475

Query: 77  RRMKCNV---------KPVANLYQYRYLSDPK----------NVQRIGVIAQEISKIRPD 117
            R+K  +         + +  L    Y    +            QR G+IAQE+  + PD
Sbjct: 476 IRLKEGISEKETAEAIENLLKLRVVDYRYKSEVADVWGLDEQQRQRTGLIAQELQAVLPD 535

Query: 118 TVVENNQGIKSVDYGRLFNIGQIQTKQK 145
            V +      ++D GR+F    + T+Q 
Sbjct: 536 AVRDIGD-YLTIDEGRVFYETVMATQQL 562


>gi|332096585|gb|EGJ01579.1| long tail fiber protein p37 [Shigella boydii 3594-74]
          Length = 111

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 39/107 (36%), Gaps = 17/107 (15%)

Query: 60  FYDAVNMGYQLAPLVSDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIA 108
                N  +    + SD+R K N+  +             LY+ +Y +D      +G+IA
Sbjct: 1   MTVTGNGSFNDIQIRSDKRNKRNLVKLDNALDRLEALTGYLYEIQYSAD-GWQTSVGLIA 59

Query: 109 QEISKIRPDTVVENNQ-----GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           Q+  K  P  V E+           ++Y  +  +     K  ++  +
Sbjct: 60  QDAQKALPKLVTEDADVISGEKRLRLNYNGIIALLVEGFKTLRHEIK 106


>gi|291290471|dbj|BAI83266.1| long tail fiber distal subunit [Enterobacteria phage AR1]
          Length = 1103

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 17/92 (18%)

Query: 70   LAPLVSDRRMKCNV-------KPVANLYQYRY--------LSDPKNVQRIGVIAQEISKI 114
               + SD R+K ++       + ++ +  Y Y          + K     G+IAQE+  I
Sbjct: 988  DVYVRSDIRVKKDLVKFENASEKLSKINGYTYMQKRGLDEEGNQKWEPNAGLIAQEVQAI 1047

Query: 115  RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
             P+ V  +  G  +  ++Y  +  +      +
Sbjct: 1048 LPELVEGDPDGEALLRLNYNGVIGLNTAAINE 1079


>gi|228861180|ref|YP_002854203.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB51]
 gi|227438854|gb|ACP31166.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB51]
          Length = 1103

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 17/92 (18%)

Query: 70   LAPLVSDRRMKCNV-------KPVANLYQYRY--------LSDPKNVQRIGVIAQEISKI 114
               + SD R+K ++       + ++ +  Y Y          + K     G+IAQE+  I
Sbjct: 988  DVYVRSDIRVKKDLVKFENASEKLSKINGYTYMQKRGLDEEGNQKWEPNAGLIAQEVQAI 1047

Query: 115  RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
             P+ V  +  G  +  ++Y  +  +      +
Sbjct: 1048 LPELVEGDPDGEALLRLNYNGVIGLNTAAINE 1079


>gi|30267424|gb|AAP04368.1| gp 36-37.1 [Enterobacteria phage RB43]
          Length = 756

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 36/121 (29%), Gaps = 16/121 (13%)

Query: 46  YQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRY---- 94
           Y +                +  +    + SD ++K N   + N       L    Y    
Sbjct: 630 YFDGDGSFSTSTGNITAGNSGYFNDVYIRSDEKLKSNFNKIENALDKVELLNGLTYDKAS 689

Query: 95  -LSDPKNVQRIGVIAQEISKIRPDTVVENNQ----GIKSVDYGRLFNIGQIQTKQKKNTA 149
            +      +  G+IAQE+ K+ P+ V          +  +       +     K+ +   
Sbjct: 690 YIGGETVKREAGLIAQELQKVLPEAVSVGKDTKENEVLVISPTATIALLVEAIKELREEV 749

Query: 150 Q 150
           +
Sbjct: 750 R 750


>gi|284504080|ref|YP_003406795.1| hypothetical protein MAR_ORF045 [Marseillevirus]
 gi|282935518|gb|ADB03833.1| hypothetical protein MAR_ORF045 [Marseillevirus]
          Length = 382

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/144 (11%), Positives = 40/144 (27%), Gaps = 12/144 (8%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +     +   +       +            L                   +    S 
Sbjct: 238 GTSGTNRIVLGASAVGATDNEMTIAPTITQWRSLGLASAAAANTLQIDPATGIITQAASS 297

Query: 77  RRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI- 126
           +R K N++ +           L  Y Y       +  G+IA++   + P+ V  + +G  
Sbjct: 298 QRFKENIRDLEVDTSKIYDLALRTYNY--KSDGREDYGLIAEDTYDVLPEIVTLDAEGNP 355

Query: 127 KSVDYGRLFNIGQIQTKQKKNTAQ 150
             + +  L  +   + ++ K   +
Sbjct: 356 HGIKHLTLVMLLVAELQRLKERVE 379


>gi|32453735|ref|NP_861944.1| gp37 long tail fiber distal subunit [Enterobacteria phage RB69]
 gi|32350554|gb|AAP76153.1| gp37 long tail fiber distal subunit [Enterobacteria phage RB69]
          Length = 1103

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 36/92 (39%), Gaps = 17/92 (18%)

Query: 70   LAPLVSDRRMKCNV-------KPVANLYQYRY--------LSDPKNVQRIGVIAQEISKI 114
               + SD R+K N+       + ++ +  Y Y          + K     G+IAQE+  I
Sbjct: 988  DVYVRSDIRVKKNLVKFENASEKLSKINGYTYMQKRGLDEEGNQKWEPNAGLIAQEVQAI 1047

Query: 115  RPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
             P+ V  +  G  +  ++Y  +  +      +
Sbjct: 1048 LPELVEGDPDGEALLRLNYNGVIGLNTAAINE 1079


>gi|296447580|ref|ZP_06889501.1| hypothetical protein MettrDRAFT_3217 [Methylosinus trichosporium
           OB3b]
 gi|296254895|gb|EFH02001.1| hypothetical protein MettrDRAFT_3217 [Methylosinus trichosporium
           OB3b]
          Length = 143

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 37/84 (44%), Gaps = 8/84 (9%)

Query: 74  VSDRRMKCNVKPVAN----LYQYRYLSDPKNVQRIGVIAQEI--SKIRPDTVVENNQGIK 127
            SDRR+K ++  +      L  YR+     + +  G++AQ++   +   D V  N +G  
Sbjct: 53  PSDRRLKTDIVSIGETENGLKLYRFRYIGDDREFCGLMAQDLLADERYRDAVALNKEGYY 112

Query: 128 S-VDYGRLFNIGQIQTKQKKNTAQ 150
             VDY     +  + T + +   +
Sbjct: 113 YCVDYAA-VGLESLVTNEMRQAGE 135


>gi|116326465|ref|YP_803185.1| large distal tail fiber subunit [Enterobacteria phage RB32]
 gi|115344058|gb|ABI95067.1| large distal tail fiber subunit [Enterobacteria phage RB32]
          Length = 1027

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 40/126 (31%), Gaps = 21/126 (16%)

Query: 46   YQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP--------VANLYQYRYL-- 95
            +            +F     +      + SDRR+K NV+         V  L    Y   
Sbjct: 882  HVGGSDYAFAFNGDFTAGAAVYCNDVYIRSDRRLKINVEDYEENAVDKVNKLKVKTYDKV 941

Query: 96   ----SDPKNVQRIGVIAQEISKIRPDTVVE-------NNQGIKSVDYGRLFNIGQIQTKQ 144
                        IG+IAQ++ ++ P+ V         N + I ++    +  +     ++
Sbjct: 942  KSLSDREVIGHEIGIIAQDLQEVLPEAVSTSSVGSQDNPEEILTISNSAVNALLIKAIQE 1001

Query: 145  KKNTAQ 150
                 +
Sbjct: 1002 MSEEIK 1007


>gi|47224519|emb|CAG08769.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 1166

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 35/99 (35%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK--------NVQRIGVIAQEISKIRP 116
            SD R K NV+          ++ +    Y   P+        N    GVIAQE+ +I P
Sbjct: 660 PSDIRAKENVQEVNTTDNLKRISQMRLVHYQYKPEFAATVGIENTAETGVIAQEVQQILP 719

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           + V E              +  V+  R+F       K+ 
Sbjct: 720 EAVKEGGDVVCANGETIANLLVVNKERIFMENVGAVKEL 758


>gi|156390431|ref|XP_001635274.1| predicted protein [Nematostella vectensis]
 gi|156222366|gb|EDO43211.1| predicted protein [Nematostella vectensis]
          Length = 356

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 37/99 (37%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKPVA-----------NLYQYRYLSDP------KNVQRIGVIAQEISKIRP 116
            SD R+K N+  +             LY+Y Y  D             GV+AQE+ ++ P
Sbjct: 146 PSDIRVKENIIEIDTREQLRNVSRMKLYRYSYSQDYLEVAGLNTDPDTGVLAQEVKEVLP 205

Query: 117 DTVVENNQGIKS----------VDYGRLFNIGQIQTKQK 145
           D V E+   + +          V+  R+F       K+ 
Sbjct: 206 DAVRESEDLVLAGGKTIEKLLVVNKERIFMENVGAVKEL 244


>gi|146311867|ref|YP_001176941.1| hypothetical protein Ent638_2216 [Enterobacter sp. 638]
 gi|145318743|gb|ABP60890.1| hypothetical protein Ent638_2216 [Enterobacter sp. 638]
          Length = 423

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/109 (17%), Positives = 36/109 (33%), Gaps = 7/109 (6%)

Query: 19  TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
           ++     S +     A    A +   +   +           ++A           SD+R
Sbjct: 260 SIRGYWYSGSWQLGGARGGGANLQSVVLGIKGDSSSPTVSWSFNANGQATGTWVNNSDQR 319

Query: 79  MKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
           +K ++  +         L  Y +      V   G IAQE+ ++ PD V 
Sbjct: 320 IKTDIVIIPSPLAAMKKLRGYSWRRLDSGVTGFGFIAQEVQEVFPDAVN 368


>gi|228861560|ref|YP_002854581.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB14]
 gi|227438576|gb|ACP30889.1| gp37 large distal tail fiber subunit [Enterobacteria phage RB14]
          Length = 981

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/138 (15%), Positives = 45/138 (32%), Gaps = 17/138 (12%)

Query: 30  PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN------- 82
              I  +     + +    Q          FY   N  +    + SD R+K N       
Sbjct: 824 GQAIIRVGSTEASPDAGHPQAVFEFHHDGFFYTPGNGSFSDVYIRSDSRLKINKEELEYG 883

Query: 83  -VKPVANLYQYRY------LSDPKNVQRIGVIAQEISKIRPDTVVE---NNQGIKSVDYG 132
            V+ V  L  Y Y             + +G+IAQ++ K  P+ V +   +   + ++   
Sbjct: 884 AVEKVCRLKVYIYDKVKSIKDRSVIKREVGIIAQDLEKELPEAVSKVEVDGSDVLTISNS 943

Query: 133 RLFNIGQIQTKQKKNTAQ 150
            +  +     ++     +
Sbjct: 944 AVNALLIKAIQEMSEEIK 961


>gi|163644213|dbj|BAF95750.1| tail fiber protein [Enterobacteria phage KEP10]
          Length = 982

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/138 (15%), Positives = 45/138 (32%), Gaps = 17/138 (12%)

Query: 30  PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN------- 82
              I  +     + +    Q          FY   N  +    + SD R+K N       
Sbjct: 825 GQAIIRVGSTEASPDAGHPQAVFEFHHDGFFYTPGNGSFSDVYIRSDSRLKINKEELEYG 884

Query: 83  -VKPVANLYQYRY------LSDPKNVQRIGVIAQEISKIRPDTVVE---NNQGIKSVDYG 132
            V+ V  L  Y Y             + +G+IAQ++ K  P+ V +   +   + ++   
Sbjct: 885 AVEKVCRLKVYIYDKVKSIKDRSVIKREVGIIAQDLEKELPEAVSKVEVDGSDVLTISNS 944

Query: 133 RLFNIGQIQTKQKKNTAQ 150
            +  +     ++     +
Sbjct: 945 AVNALLIKAIQEMSEEIK 962


>gi|38640257|ref|NP_944213.1| hypothetical protein Aeh1p335 [Aeromonas phage Aeh1]
 gi|33414942|gb|AAQ17985.1| hypothetical protein Aeh1ORF316w [Aeromonas phage Aeh1]
          Length = 1358

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 34/106 (32%), Gaps = 14/106 (13%)

Query: 55   EGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVI 107
                      N  +    + SD R+K N KP+         L    Y    K  +  G+I
Sbjct: 1242 YTAGGMKAEGNGSFNDVQIRSDERLKSNFKPILNALDKVDTLSGLTYDKVGKTTREAGII 1301

Query: 108  AQEISKIRPDTVVE-----NNQ--GIKSVDYGRLFNIGQIQTKQKK 146
            AQ++  + P+         +       +V    +  +     K+ +
Sbjct: 1302 AQKLKAVLPEATGTVLNAMDPTAIEYLTVSNSGVNALLVEAIKELR 1347


>gi|118090961|ref|XP_420899.2| PREDICTED: similar to KIAA0954 protein [Gallus gallus]
          Length = 1434

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 34/99 (34%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K +++          ++ +    Y   P         N    GVIAQE+ +I P
Sbjct: 833 PSDVRVKEDIQEVDTTEQLKRISRMRLVHYNYTPEFAATVGIDNTSETGVIAQEVKEILP 892

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           + V +                 V+  R+F       K+ 
Sbjct: 893 EAVKDTGDLVFSNGKTLENFLVVNKERIFMENVGAVKEL 931


>gi|86140522|ref|ZP_01059081.1| hypothetical protein MED217_15260 [Leeuwenhoekiella blandensis
           MED217]
 gi|85832464|gb|EAQ50913.1| hypothetical protein MED217_15260 [Leeuwenhoekiella blandensis
           MED217]
          Length = 603

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 46/149 (30%), Gaps = 19/149 (12%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
                   + I  +    +  +  A    +  +  +S +          V     L    
Sbjct: 420 TNATGSNNVIIGYDADATVTGLTNAIAIGSGVRIGVSNKIRLGNTAITVVEAQVAL-STT 478

Query: 75  SDRRMKCNVKP-------VANLYQYRY--LSDPKNVQRIGVIAQEISKIRPD-------T 118
           SDRR K  +         +  +    Y   S+  N +  GVIAQE+ ++  D        
Sbjct: 479 SDRRYKEEIATLPLGLDFINQIRPVEYVRKSNADNTKEWGVIAQELQQVLADTGYDGAGL 538

Query: 119 VVEN--NQGIKSVDYGRLFNIGQIQTKQK 145
           + E+   +   SV Y  L        ++ 
Sbjct: 539 ISEDGSEEHYLSVRYTDLIAPMIKAIQEL 567


>gi|324500951|gb|ADY40431.1| Myelin gene regulatory factor [Ascaris suum]
          Length = 992

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 43/128 (33%), Gaps = 20/128 (15%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA--------- 87
           + + +  N     +   +               +    SDRR+K  +  V          
Sbjct: 480 NGSTLFYNSGSVAIGMDRAMAPLTVGGDIYCSGVVHRPSDRRVKEEIHEVDTKDAMSRLA 539

Query: 88  NLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNI 137
            +    Y   P+          N  R+GVIAQE+++I PD V +N      VD  R+F  
Sbjct: 540 QIRVVGYSYKPEIALQWGLSEENRHRVGVIAQELAEILPDAVTDNGD-FLQVDDSRIFYE 598

Query: 138 GQIQTKQK 145
                 + 
Sbjct: 599 TVAAATEL 606


>gi|157161023|ref|YP_001458341.1| L-shaped tail fiber protein [Escherichia coli HS]
 gi|157066703|gb|ABV05958.1| L-shaped tail fiber protein [Escherichia coli HS]
          Length = 1258

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 48/152 (31%), Gaps = 26/152 (17%)

Query: 15   MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
            +QN    +LP S+         +   +  +      +++    + F     +        
Sbjct: 1055 LQNSGNAELPFSVRVWGSSTRQNVFEVGTSAAYLFYAQKTSAGQLFDVNGAINCTTLNQS 1114

Query: 75   SDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV------- 120
            SDR +K ++  +++       +  Y Y      +   GVIAQE+ +  P+ V        
Sbjct: 1115 SDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPYAGVIAQEVMEAIPEAVGSFTHYGE 1174

Query: 121  ------------ENNQGIKSVDYGRLFNIGQI 140
                               +VDY  +  +   
Sbjct: 1175 ELQGPTVDGNELREETRYLNVDYAAVTGLLVQ 1206


>gi|49474618|ref|YP_032660.1| hypothetical protein BQ11070 [Bartonella quintana str. Toulouse]
 gi|49240122|emb|CAF26568.1| hypothetical protein BQ11070 [Bartonella quintana str. Toulouse]
          Length = 374

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 54/155 (34%), Gaps = 24/155 (15%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +++  Q ++++  L++  T         +   I             Q  L          
Sbjct: 218 LEKDNQGWNQLERLLRLGTKAAGDYGTKSGQVITTPSVTKDPFGDVQQLLGLMGGILG-- 275

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVAN-----LYQYRYLSDPKNVQRIGVIAQEISKIR 115
                        +SD R K N+ P+       +Y + Y  DP      GVIAQ++ +++
Sbjct: 276 -------------LSDLRAKENIVPIGEKNGYPIYIFNYKGDP--QLYRGVIAQDVLRLK 320

Query: 116 PDTVVEN-NQGIKSVDYGRLFNIGQIQTKQKKNTA 149
           PD V  N    +  VDY +   +   +    KN  
Sbjct: 321 PDAVYINAKTKLLHVDYRK-IGLQIEKITASKNKI 354


>gi|85701830|ref|NP_001028505.1| hypothetical protein LOC237558 [Mus musculus]
 gi|74190381|dbj|BAE25877.1| unnamed protein product [Mus musculus]
 gi|187956311|gb|AAI50916.1| Gene model 239, (NCBI) [Mus musculus]
 gi|187957126|gb|AAI50924.1| Gene model 239, (NCBI) [Mus musculus]
          Length = 904

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 34/99 (34%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K N++          +A +   +Y   P            + G+IAQE+ +I P
Sbjct: 445 PSDSRVKENIQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGINTAHQTGMIAQEVQEILP 504

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 505 RAVREVGDVTGGNGETLENFLMVDKDQIFMENVGAVKQL 543


>gi|74188453|dbj|BAE25858.1| unnamed protein product [Mus musculus]
          Length = 904

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 34/99 (34%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K N++          +A +   +Y   P            + G+IAQE+ +I P
Sbjct: 445 PSDSRVKENIQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGINTAHQTGMIAQEVQEILP 504

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 505 RAVREVGDVTGGNGETLENFLMVDKDQIFMENVGAVKQL 543


>gi|42522290|ref|NP_967670.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
 gi|39574821|emb|CAE78663.1| cell wall surface anchor family protein [Bdellovibrio bacteriovorus
            HD100]
          Length = 1365

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 33/152 (21%), Gaps = 29/152 (19%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVS 75
               T+                       N +    +  +       +            S
Sbjct: 1178 TGATLHLNYQGDFTGGVQVGSLLRPRTDNAFDLGTTTYRWKAVYAVNGTIQT-------S 1230

Query: 76   DRRMKCNVKP-------VANLYQYRYLSDPKN-----VQRIGVIAQEISKIRPDTV---- 119
            D+R+K  V+        V  L    Y               G +AQE+      +     
Sbjct: 1231 DQRLKAEVQDLSQGLDFVMALQPKSYKWKSDQNDPAAKTHWGFMAQELEAQVKRSTASAA 1290

Query: 120  ------VENNQGIKSVDYGRLFNIGQIQTKQK 145
                   E N     V+Y  L        ++ 
Sbjct: 1291 PVGLIHHETNSDYYGVNYSELIAPVVKALQEL 1322


>gi|116748330|ref|YP_845017.1| hypothetical protein Sfum_0885 [Syntrophobacter fumaroxidans MPOB]
 gi|116697394|gb|ABK16582.1| conserved hypothetical protein [Syntrophobacter fumaroxidans MPOB]
          Length = 428

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 40/153 (26%), Gaps = 20/153 (13%)

Query: 4   KQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQ----------NIYQNQLSER 53
           +    +                 L +      + + G A                     
Sbjct: 196 RNALKNNATGNTNLALGYGAGSLLTSGGENIYLGHPGAASESKTLRLGKGQTRAFVAGVA 255

Query: 54  KEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDPK--NVQRI 104
                     V    QL    S  R K ++ P+         L    +    +   +   
Sbjct: 256 AAAVAGNAVYVTKNGQLGIKASSARYKTDIAPLGERSDSLHQLRPVTFHYKEEARGLPEY 315

Query: 105 GVIAQEISKIRPDTVVENN-QGIKSVDYGRLFN 136
           G+IA+E++ + P+ V  +   G+  V Y  L  
Sbjct: 316 GLIAEEVAVVYPELVTRDPRGGVVGVRYEALIP 348


>gi|310005750|gb|ADP00137.1| predicted protein [Cyanophage NATL1A-7]
          Length = 1202

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 49/157 (31%), Gaps = 22/157 (14%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVS 75
            Q   +     S +N +       A           S   + +     AV     +   +S
Sbjct: 1034 QGTFIQTDSSSYSNLSVNNSHSDADSVDFFQCRDSSNNLKLQILSGGAVQNANNIYQQIS 1093

Query: 76   DRRMKCNV-------KPVANLYQYRYLSDPKNV----QRIGVIAQEISKIRPDTVVENNQ 124
            D ++K N+       + +  +    +           ++IGV+AQEI  I P  + EN  
Sbjct: 1094 DVKLKENIVDANSQWEDIKAIKIRNWNFKASTGLATHKQIGVVAQEIETISPGLIDENID 1153

Query: 125  -----------GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                         KSV Y  L+       ++     +
Sbjct: 1154 RDPETQVDLGTKTKSVKYSILYMKAIKALQEAMAKIE 1190


>gi|307105763|gb|EFN54011.1| hypothetical protein CHLNCDRAFT_58365 [Chlorella variabilis]
          Length = 1346

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 35/88 (39%), Gaps = 17/88 (19%)

Query: 75  SDRRMKCNVKPVAN----------LYQYRYLSDPKNVQRIGVIAQEISKIRPD------- 117
           SD  MK  V+              +  Y Y     + QR+GV+AQ++  +          
Sbjct: 390 SDASMKEGVRAFEQGEKAVAIAAEITTYLYRYKGTDAQRLGVVAQQVRAVLEQHGATDMN 449

Query: 118 TVVENNQGIKSVDYGRLFNIGQIQTKQK 145
            V ++ QG  SVDYG L  +     +Q 
Sbjct: 450 LVRQDPQGALSVDYGGLQVLLPAAVQQL 477


>gi|167382850|ref|XP_001736295.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165901465|gb|EDR27548.1| hypothetical protein EDI_093390 [Entamoeba dispar SAW760]
          Length = 552

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 45/134 (33%), Gaps = 16/134 (11%)

Query: 20  VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRM 79
           V +   ++   +    +      Q        +R     E      +        SD ++
Sbjct: 138 VQQFDWNITQNSEQNTLTSIPFIQIELLQNALKRLHVAGEI-----LAENGFLQRSDSKL 192

Query: 80  KCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYG 132
           K ++KP+ N       L   +Y     +  + G IAQE++K  P+       G  S+D  
Sbjct: 193 KTSIKPLTNSLQKLFKLVGVQYNYKEDSTTKYGFIAQEVNKTCPEL---APNGT-SLDVV 248

Query: 133 RLFNIGQIQTKQKK 146
            +  I     K+  
Sbjct: 249 GILPIIIESLKEIN 262


>gi|293348602|ref|XP_001080934.2| PREDICTED: myelin gene regulatory factor-like [Rattus norvegicus]
          Length = 966

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 35/99 (35%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K NV+          +A +   +Y   P            + G+IAQE+ +I P
Sbjct: 505 PSDIRVKENVQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGIDTAHQTGMIAQEVQEILP 564

Query: 117 DTVVENN----------QGIKSVDYGRLFNIGQIQTKQK 145
             V E            +    VD  ++F       KQ 
Sbjct: 565 RAVREVGGVTCGNGETLENFLMVDKDQIFMENVGAVKQL 603


>gi|255038797|ref|YP_003089418.1| hypothetical protein Dfer_5053 [Dyadobacter fermentans DSM 18053]
 gi|254951553|gb|ACT96253.1| hypothetical protein Dfer_5053 [Dyadobacter fermentans DSM 18053]
          Length = 533

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/173 (14%), Positives = 50/173 (28%), Gaps = 24/173 (13%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
           D     F+  L             +            + +  +     +       +   
Sbjct: 228 DNTSGQFNTYLGYAAGGNATISNSAAIGANAKVTASNSMVLGDNANVGIGISAPSYRLHL 287

Query: 62  DAVNMG---YQLAPLVSDRRMKCNVKP-------VANLYQ--YRYLSD----PKNVQRIG 105
           +  + G     L  + SD R+K N+         +  +    ++Y           + +G
Sbjct: 288 NLNSAGKPGSSLWAVASDSRLKQNITEFTDGLALLKQIKPVWFQYNGKAGIETGEQKFVG 347

Query: 106 VIAQEISKIRPDTVV--------ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           +IAQE+ KI P TV          N       D   +  I     K+++   +
Sbjct: 348 IIAQEMQKIAPYTVGSFTYQDSLGNKSEYLDYDANAVTYILINSVKEQQEVIE 400


>gi|218553352|ref|YP_002386265.1| hypothetical protein ECIAI1_0803 [Escherichia coli IAI1]
 gi|218360120|emb|CAQ97668.1| hypothetical protein ECIAI1_0803 [Escherichia coli IAI1]
          Length = 1253

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/176 (11%), Positives = 47/176 (26%), Gaps = 39/176 (22%)

Query: 8    FHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQL-------------SERK 54
             +  + L            +        + +A         Q              +++ 
Sbjct: 1030 VNSTVDLTLTKQTGTGNRFVLQNLGNTELSFAAKVWGSSDRQNVFEVGTSAAYLFYAQKT 1089

Query: 55   EGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVI 107
               + F     +        SDR +K ++  +++       +  Y Y      +   GVI
Sbjct: 1090 SAGQLFDVNGAINCTTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPYAGVI 1149

Query: 108  AQEISKIRPDTVV-------------------ENNQGIKSVDYGRLFNIGQIQTKQ 144
            AQE+ +  P+ V                           +VDY  +  +     ++
Sbjct: 1150 AQEVMEAIPEAVGSFTHYGEELQGPTVDGNELREETRYLNVDYSAVTGLLVQVARE 1205


>gi|67482089|ref|XP_656394.1| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gi|56473590|gb|EAL51009.1| hypothetical protein EHI_153210 [Entamoeba histolytica HM-1:IMSS]
          Length = 551

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 50/149 (33%), Gaps = 18/149 (12%)

Query: 6   QAFHEILSLMQNVT-VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
           Q  + I +       V +   ++N  +    +      Q        +R     E     
Sbjct: 123 QTLN-IQNSSSFSPLVQQFDWNINQNSEYNTLPSIPFIQIEILQNALKRLHVAGEI---- 177

Query: 65  NMGYQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPD 117
            +        SD ++K +++P+ N       L   +Y     N  + G IAQE++K  P+
Sbjct: 178 -LAENGFLQRSDSKLKTSIEPLTNSLQKLLKLVGVQYNYKEDNTVKYGFIAQEVNKTCPE 236

Query: 118 TVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
                  G  S+D   +  I     K+  
Sbjct: 237 L---APNGT-SLDVVGILPIIIESLKEIN 261


>gi|118082416|ref|XP_425440.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 468

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK--------NVQRIGVIAQEISKIRP 116
            SD R K N++          +  +    Y   P+        N    G+IAQE+ ++ P
Sbjct: 279 PSDSRAKENIREVDTNEQLRRITQMRLVEYDYKPEFASVMGIENTHETGIIAQEVKELLP 338

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 339 QAVKEAGDVAFNDGEKIENFLMVDKDQIFMENVGAVKQL 377


>gi|291567518|dbj|BAI89790.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 238

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 39/146 (26%), Gaps = 28/146 (19%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
                Y   +  +  + +  R          +N         SD + K  +         
Sbjct: 83  YNGQTYFIKSSTLSSSGVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSE 142

Query: 86  VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
           +  L    +  +          + ++ G+IAQE+  I P+ V                  
Sbjct: 143 INALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVIKNDHTDSPEVDDKKI 202

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 203 DYLTIMYDKLIPLVIAAIQELSEKID 228


>gi|291567973|dbj|BAI90245.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 237

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/157 (11%), Positives = 42/157 (26%), Gaps = 28/157 (17%)

Query: 22  KLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKC 81
             P +  +        Y   +  +  + +  R          +N         SD + K 
Sbjct: 71  GAPNNRYSIQLYNGQTYFIKSSTLSSSGVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKT 130

Query: 82  NVKP-------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG- 125
            +         +  L    +  +          + ++ G+IAQE+  I P+ V       
Sbjct: 131 LLSKPTLGLSEINALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVIKNDH 190

Query: 126 ------------IKSVDYGRLFNIGQIQTKQKKNTAQ 150
                         ++ Y +L  +     ++      
Sbjct: 191 TDSPEVDDKKIDYLTIMYDKLIPLVIAAIQELSEKID 227


>gi|284504099|ref|YP_003406814.1| hypothetical protein MAR_ORF067 [Marseillevirus]
 gi|282935537|gb|ADB03852.1| hypothetical protein MAR_ORF067 [Marseillevirus]
          Length = 383

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 30/116 (25%), Gaps = 7/116 (6%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +         + T     +            L                   +    S 
Sbjct: 239 GTSGTNRIALGASATCGVDNEMTIAPTITQWRSLGLSSAAAANTLQINPATGIITQAASS 298

Query: 77  RRMKCNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG 125
           +R K N++ +         L    Y       +  G+IA+E   I PD V  + +G
Sbjct: 299 KRFKENIRDLEVDTRALHELPMKTYNYKKDGEKDHGLIAEEAYDILPDIVTLDAEG 354


>gi|327409559|ref|YP_004346979.1| hypothetical protein LAU_0011 [Lausannevirus]
 gi|326784733|gb|AEA06867.1| conserved hypothetical protein [Lausannevirus]
          Length = 383

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/144 (11%), Positives = 40/144 (27%), Gaps = 12/144 (8%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +     +   +       +    +       L                   +    S 
Sbjct: 239 GTSGTNRIVLGASAVGATDNELTISSTITQWRSLGLSSAAAANTLQINPATGIITQAASS 298

Query: 77  RRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI- 126
           +R K  ++ +          +L  Y Y       +  G+IA++   + P+ V  + +G  
Sbjct: 299 QRFKDKIRDLEVDTERLYDLSLKAYEY--KSDGTEDYGLIAEDTYDVLPEIVTLDAEGKP 356

Query: 127 KSVDYGRLFNIGQIQTKQKKNTAQ 150
             + +  L  +   + +  K   Q
Sbjct: 357 HGIRHFTLVMLLLAELQNLKQKVQ 380


>gi|307310207|ref|ZP_07589856.1| hypothetical protein SinmeBDRAFT_5289 [Sinorhizobium meliloti
           BL225C]
 gi|306899759|gb|EFN30384.1| hypothetical protein SinmeBDRAFT_5289 [Sinorhizobium meliloti
           BL225C]
          Length = 674

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 34/122 (27%), Gaps = 24/122 (19%)

Query: 30  PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK----- 84
            +   P   + +A +    +             +V          SD R+K +++     
Sbjct: 445 ASGYNPFYQSRLATDGAVQEFYRENSSVGGI--SVTATGTSYSTTSDYRLKSDIQPIVTF 502

Query: 85  ---------------PVANLYQY--RYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIK 127
                           +  L     R+ + P+     G IA E  ++ P  V      + 
Sbjct: 503 SLTPEQFDVLDHAELKIMALRPVFHRWNNAPEKGVVTGFIAHEAQQVVPHAVTGKKDEVV 562

Query: 128 SV 129
            V
Sbjct: 563 EV 564


>gi|284504066|ref|YP_003406781.1| hypothetical protein MAR_ORF026 [Marseillevirus]
 gi|282935504|gb|ADB03819.1| hypothetical protein MAR_ORF026 [Marseillevirus]
          Length = 384

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/140 (12%), Positives = 39/140 (27%), Gaps = 12/140 (8%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +     +   +       +            L                   +    S 
Sbjct: 240 GTSGTNRIVLGASAVGATDNEMTIAPTITRWRSLGLSSAAAANTLQIDPATGIITQAASS 299

Query: 77  RRMKCNVKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI- 126
           RR K N++ +          +L  Y Y       +  G+IA++   + P+ V  + +G  
Sbjct: 300 RRFKENIRDLDVDTERLYDLSLKAYNY--KSDGKEDFGLIAEDTYDVLPEIVTLDAEGNP 357

Query: 127 KSVDYGRLFNIGQIQTKQKK 146
             + +  L  +   + +  K
Sbjct: 358 HGIKHLTLAMLLLAEVQNLK 377


>gi|326919927|ref|XP_003206228.1| PREDICTED: LOW QUALITY PROTEIN: myelin gene regulatory factor-like
           [Meleagris gallopavo]
          Length = 1105

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 34/99 (34%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K +++          ++ +    Y   P         N    GVIAQE+ +I P
Sbjct: 541 PSDVRVKEDIQEVDTTEQLKRISRMRLVHYNYTPEFAATVGIDNTSETGVIAQEVKEILP 600

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           + V +                 V+  R+F       K+ 
Sbjct: 601 EAVKDTGNLVFSNGKTLENFLVVNKERIFMENVGAVKEL 639


>gi|332221363|ref|XP_003259831.1| PREDICTED: myelin gene regulatory factor-like [Nomascus leucogenys]
          Length = 564

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 369 PSDSRAKQNIQEVDTNEQLKRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVQEILP 428

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 429 RAVREVGDVTCGNGETLENFLMVDKDQIFMENVGAVKQL 467


>gi|297262945|ref|XP_001108573.2| PREDICTED: myelin gene regulatory factor-like [Macaca mulatta]
          Length = 898

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 450 PSDSRAKQNIQEVDTNEQLKRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVQEILP 509

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 510 RAVREVGDVTCENGETLENFLMVDKDQIFMENVGAVKQL 548


>gi|239750374|ref|XP_001718110.2| PREDICTED: myelin gene regulatory factor [Homo sapiens]
 gi|310110393|ref|XP_001716702.2| PREDICTED: myelin gene regulatory factor [Homo sapiens]
          Length = 972

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 512 PSDSRAKQNIQEVDTNEQLKRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVQEILP 571

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 572 RAVREVGDVTCGNGETLENFLMVDKDQIFMENVGAVKQL 610


>gi|169204180|ref|XP_001718960.1| PREDICTED: myelin gene regulatory factor [Homo sapiens]
          Length = 972

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 512 PSDSRAKQNIQEVDTNEQLKRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVQEILP 571

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 572 RAVREVGDVTCGNGETLENFLMVDKDQIFMENVGAVKQL 610


>gi|119617649|gb|EAW97243.1| chromosome 12 open reading frame 28 [Homo sapiens]
          Length = 786

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 326 PSDSRAKQNIQEVDTNEQLKRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVQEILP 385

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 386 RAVREVGDVTCGNGETLENFLMVDKDQIFMENVGAVKQL 424


>gi|310005749|gb|ADP00136.1| predicted protein [Cyanophage NATL1A-7]
          Length = 557

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/147 (13%), Positives = 39/147 (26%), Gaps = 23/147 (15%)

Query: 23  LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN 82
             +                     Q     R +      +           +SD ++K N
Sbjct: 403 YGVHAYFNNSDPDTGNYPFFLGQDQTTTRFRVQSNGNVENH----DNSYGSISDIKLKEN 458

Query: 83  VKPVA---------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG-------- 125
           +              +  + + +     + +GV+AQE+    P  VVE            
Sbjct: 459 IVDAGSQWEDIKAIKVRNFNFKASKSKKKLLGVVAQELETTSPGLVVETPDEDLDHNDLG 518

Query: 126 --IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              KSV Y  L+       ++     +
Sbjct: 519 TTTKSVRYSILYMKAIKALQEAMAKIE 545


>gi|319407668|emb|CBI81316.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 371

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 47/136 (34%), Gaps = 19/136 (13%)

Query: 3   QKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
           Q  QA++++  L+    V                    I ++  Q+        K     
Sbjct: 220 QDNQAWNQLERLL---QVGTTAAGNYGTKTGESTTMPSITKDPLQDAQRVLGLLKGIIG- 275

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPVANLYQY---RYLSDPKNVQRIGVIAQEISKIRPDTV 119
                      +SD  +K N+  V     Y    +     + +  GV+AQ++ ++ PD V
Sbjct: 276 -----------LSDVNVKENIVLVGEKNGYPLYEFNYKGSSQRYRGVLAQDLVRLNPDAV 324

Query: 120 VEN-NQGIKSVDYGRL 134
             N    +  V+Y +L
Sbjct: 325 YMNIKTHLLHVNYNKL 340


>gi|260826928|ref|XP_002608417.1| hypothetical protein BRAFLDRAFT_137080 [Branchiostoma floridae]
 gi|229293768|gb|EEN64427.1| hypothetical protein BRAFLDRAFT_137080 [Branchiostoma floridae]
          Length = 348

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 36/105 (34%), Gaps = 17/105 (16%)

Query: 39  AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP---------VANL 89
                +  +  ++  +  +                 SD R K N+K          V+ L
Sbjct: 173 PDAIYHQGRVGINTERPDEALVVHGNVKVSGHIMQPSDMRAKENIKEADTKEALTNVSQL 232

Query: 90  YQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQGI 126
             Y Y   P          V   GV+AQE+ ++ PD V+E  + I
Sbjct: 233 KVYNYNYKPEFAEKMGIDKVDDKGVLAQEVKEVIPDAVIETGEDI 277


>gi|126339419|ref|XP_001369709.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 898

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +  +    Y   P         +  + G+IAQE+ +I P
Sbjct: 437 PSDSRAKQNIQEVDTNEQLRRINRMRIVEYDYKPEFASVMGINSTHQTGMIAQEVQEILP 496

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 497 RAVREVGDVTCENGNKLENFLMVDKDQIFLENVGAVKQL 535


>gi|289552035|gb|ADD10651.1| gp37 [Enterobacteria phage IP008]
          Length = 854

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/139 (15%), Positives = 43/139 (30%), Gaps = 17/139 (12%)

Query: 29  NPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN------ 82
               I     A  +                 FY   N  +    + SD R+K N      
Sbjct: 696 PGDSIVLSTTAEASPAAGHPNAVFEFHYDGTFYSPGNGNFNDVYIRSDGRLKINKKELEN 755

Query: 83  --VKPVANLYQYRY------LSDPKNVQRIGVIAQEISKIRPDTVVE---NNQGIKSVDY 131
             ++ V  L  Y Y             + +G+IAQ++ K  P+ V +   +   + ++  
Sbjct: 756 GALEKVCRLKVYIYDKVKSIKDRSVIKREVGIIAQDLEKELPEAVSKVEVDGSDVLTISN 815

Query: 132 GRLFNIGQIQTKQKKNTAQ 150
             +  +     ++     +
Sbjct: 816 SAVNALLIKAIQEMSEEIK 834


>gi|327278870|ref|XP_003224183.1| PREDICTED: myelin gene regulatory factor-like [Anolis carolinensis]
          Length = 1117

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 36/99 (36%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK--------NVQRIGVIAQEISKIRP 116
            SD R+K +++          ++ +    Y   P+        N    GVIAQE+ +I P
Sbjct: 630 PSDVRVKDDIQEVDTTEQLKRISKMRLVHYNYKPEFAATVGLENTFETGVIAQEVREILP 689

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           + V ++                V+  R+F       K+ 
Sbjct: 690 EAVKDSGDMVFSSGKTIENFLVVNKERIFMENVGAVKEL 728


>gi|301773628|ref|XP_002922234.1| PREDICTED: myelin gene regulatory factor-like [Ailuropoda
           melanoleuca]
          Length = 897

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 450 PSDSRAKQNIQEVDTNEQLRRIAQMRIVEYDYKPEFASSMGINTAHQTGMIAQEVREILP 509

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 510 GAVREVGDVTCENGETLQNFLMVDKDQIFMENVGAVKQL 548


>gi|291565818|dbj|BAI88090.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 238

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 39/146 (26%), Gaps = 28/146 (19%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
                Y   +  +  + +  R          +N         SD + K  +         
Sbjct: 83  YNGQTYFIKSSTLSSSGVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSE 142

Query: 86  VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
           +  L    +  +          + ++ G+IAQE+  I P+ V                  
Sbjct: 143 INALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVVKNDHTDSPEVDDKKI 202

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 203 DYLTIMYDKLIPLVIAAIQELSEKID 228


>gi|291571208|dbj|BAI93480.1| hypothetical protein [Arthrospira platensis NIES-39]
 gi|291571545|dbj|BAI93817.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 238

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 39/146 (26%), Gaps = 28/146 (19%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
                Y   +  +  + +  R          +N         SD + K  +         
Sbjct: 83  YNGQTYFIKSSTLSSSGVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSE 142

Query: 86  VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
           +  L    +  +          + ++ G+IAQE+  I P+ V                  
Sbjct: 143 INALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVIKNDHTDSPEVDDKKI 202

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 203 DYLTIMYDKLIPLVIAAIQELSEKID 228


>gi|291572056|dbj|BAI94328.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 238

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 39/146 (26%), Gaps = 28/146 (19%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
                Y   +  +  + +  R          +N         SD + K  +         
Sbjct: 83  YNGQTYFIKSSTLSSSGVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSE 142

Query: 86  VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
           +  L    +  +          + ++ G+IAQE+  I P+ V                  
Sbjct: 143 INALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVIKNDHTDSPEVDDKKI 202

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 203 DYLTIMYDKLIPLVIAAIQELSEKID 228


>gi|148232569|ref|NP_001087759.1| myelin gene regulatory factor [Xenopus laevis]
 gi|82181269|sp|Q66IV1|MRF_XENLA RecName: Full=Myelin gene regulatory factor
 gi|51703569|gb|AAH81179.1| MGC84361 protein [Xenopus laevis]
          Length = 1092

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 34/100 (34%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKC---------NVKPVANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K           +K ++ +    Y   P+         N    GVIAQE+ +I 
Sbjct: 552 PSDIRAKESVEEVDTTEQLKRISQMRLVHYHYKPEFASTVGLDENAAETGVIAQEVQEIL 611

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V E+                V+  R+F       K+ 
Sbjct: 612 PEAVKESGDLVCANGETIENFLVVNKERIFMENVGAVKEL 651


>gi|302534607|ref|ZP_07286949.1| predicted protein [Streptomyces sp. C]
 gi|302443502|gb|EFL15318.1| predicted protein [Streptomyces sp. C]
          Length = 436

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 49/142 (34%), Gaps = 17/142 (11%)

Query: 21  PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP-LVSDRRM 79
                S ++ +            N  +   ++   G   +Y     G        S RR 
Sbjct: 280 TTFTPSSHSHSSYLESGDTIAWSNGTKRVHADSVSGSGTYYAVWVQGDGTFARNTSSRRF 339

Query: 80  KCNVKPVA-------NLYQYRYLSDPKNV-------QRIGVIAQEISKIRPDTVVENNQG 125
           K NV+ +        +L    Y   PK            G+IA+E+++  P+ V  + +G
Sbjct: 340 KQNVRDIDIDPDAVLSLRPRIYDRRPKEEGSDDYLRDEFGLIAEEVAETLPEIVTYDEEG 399

Query: 126 -IKSVDYGRLFNIGQIQTKQKK 146
            I ++ Y  L  +  +   Q +
Sbjct: 400 RIDALRYD-LLGVALLSVVQDQ 420


>gi|224094045|ref|XP_002189806.1| PREDICTED: CCR4-NOT transcription complex, subunit 2 [Taeniopygia
           guttata]
          Length = 815

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 33/99 (33%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK--------NVQRIGVIAQEISKIRP 116
            SD R K N++          +  +    Y   P+        +    G+IAQE+ ++ P
Sbjct: 360 PSDSRAKQNIREVDTNEQLRRITQMRLVEYDYKPEFASVMGIKDTHETGIIAQEVKRLLP 419

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           + V E                 VD  ++F       KQ 
Sbjct: 420 EAVREVGDVACNDGEKIENFLMVDKDQIFMENVGAVKQL 458


>gi|3676460|gb|AAC61976.1| large subunit distal tail fiber [Enterobacteria phage T6]
          Length = 993

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 43/138 (31%), Gaps = 17/138 (12%)

Query: 30  PTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN------- 82
              I  +     + +    Q          FY      +    + SD R+  N       
Sbjct: 836 GQAIIRVGSTEASPDAGHPQAIFEFHHDGFFYTPGXGSFSDVYIRSDSRLNINKQQLEYG 895

Query: 83  -VKPVANLYQYRY------LSDPKNVQRIGVIAQEISKIRPDTVVE---NNQGIKSVDYG 132
            V+ V  L  Y Y             + +G+IAQ++ K  P+ V +   +   + ++   
Sbjct: 896 AVEKVCRLKVYIYDKLKSIKDRSVIKREVGIIAQDLEKELPEAVSKVEVDGSDVLTISNS 955

Query: 133 RLFNIGQIQTKQKKNTAQ 150
            +  +     ++     +
Sbjct: 956 AVNALLIKAIQEMSEEIK 973


>gi|316973175|gb|EFV56795.1| NDT80 / PhoG like DNA-binding family protein [Trichinella spiralis]
          Length = 914

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/126 (19%), Positives = 42/126 (33%), Gaps = 20/126 (15%)

Query: 39  AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA---------NL 89
                +     +   +                    SD R+K N+K V           +
Sbjct: 437 NNSIFHPGPVGVGTDRPTAALTVSGDISCTGNLYHPSDARLKQNIKEVNCAEALSRLSQI 496

Query: 90  YQYRYLSDPKNVQR----------IGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQ 139
              +Y   P+  Q+          +GVIAQE++ + PD V  N +   +VD  R+F    
Sbjct: 497 RIVQYEIRPEVSQQWQLPAEDCQRVGVIAQEVNDVLPDAVKSNGE-FLTVDDSRIFYESA 555

Query: 140 IQTKQK 145
              K+ 
Sbjct: 556 AAVKEL 561


>gi|323947426|gb|EGB43431.1| hypothetical protein EREG_01061 [Escherichia coli H120]
          Length = 1211

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 38/137 (27%), Gaps = 18/137 (13%)

Query: 32   PIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN--- 88
                     + +     Q          F        Q     SD R+K NV  ++    
Sbjct: 1053 GGVRGGSTNLDRAQLNVQSGTGAYASYLFGTDGVARCQQWLNTSDLRVKENVVRISKPLE 1112

Query: 89   ----LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ----------GIKSVDYGRL 134
                +    +          G IAQE+ KI P  VV+++            +K+VD   +
Sbjct: 1113 KMRKIQGVSWTLKTNGSTGHGFIAQEVEKIFPSAVVKSHDMELQDGTKVKDVKAVDTSGV 1172

Query: 135  FNIG-QIQTKQKKNTAQ 150
                         +  +
Sbjct: 1173 AAALHHEAILALMDKVE 1189


>gi|319408848|emb|CBI82505.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 339

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 40/136 (29%), Gaps = 21/136 (15%)

Query: 3   QKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
           Q    + ++  L+                    +     A       +     G      
Sbjct: 213 QNNLEWDQLGKLLAAGGAVSGNYGTQTGQATTLVPNNPWATVGGVGGIFGGLTG------ 266

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPVANLYQ---YRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                      +SDRR K N+  V        Y Y     + +  GV+AQ++    P+ V
Sbjct: 267 -----------LSDRRAKENIVEVGYRDGHKLYDYNYKGCSQRYRGVMAQDVLATNPEAV 315

Query: 120 VEN-NQGIKSVDYGRL 134
             N   G   VDY +L
Sbjct: 316 FLNTATGFLHVDYSKL 331


>gi|66391949|ref|YP_238874.1| gp12 [Aeromonas phage 31]
 gi|62114786|gb|AAX63634.1| gp12 [Aeromonas phage 31]
          Length = 466

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 33/119 (27%), Gaps = 13/119 (10%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRY--- 94
              + +          + A N+      + SDRR+K            +  L    Y   
Sbjct: 342 SGSDNIMATLRPGGHMWLAGNIDVNDFYIRSDRRLKHGFKPIENALDKIDLLNPGTYHKQ 401

Query: 95  ---LSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                D       G+ AQ+  K  P+ V     G  +V             K+ K   +
Sbjct: 402 YSLTDDRIVGLEAGIFAQDFQKAMPEGVRSLEDGTLTVSPMGAIAFLIQCNKELKARLE 460


>gi|37651628|ref|NP_932502.1| gp12 [Aeromonas phage 44RR2.8t]
 gi|34732928|gb|AAQ81466.1| short tail fibers [Aeromonas phage 44RR2.8t]
          Length = 466

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 33/119 (27%), Gaps = 13/119 (10%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV-------KPVANLYQYRY--- 94
              + +          + A N+      + SDRR+K            +  L    Y   
Sbjct: 342 SGSDNIMATLRPGGHMWLAGNIDVNDFYIRSDRRLKHGFKPIENALDKIDLLNPGTYHKQ 401

Query: 95  ---LSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                D       G+ AQ+  K  P+ V     G  +V             K+ K   +
Sbjct: 402 YSLTDDRIVGLEAGIFAQDFQKAMPEGVRSLEDGTLTVSPMGAIAFLIQCNKELKARLE 460


>gi|319404705|emb|CBI78307.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 371

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 47/136 (34%), Gaps = 19/136 (13%)

Query: 3   QKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
           Q  QA++++  L+    +                    I ++  ++        K     
Sbjct: 220 QDNQAWNQLERLL---QIGTKAAGNYGTKTGESTTMPAITKDPLRDAQRVLGLLKGIIG- 275

Query: 63  AVNMGYQLAPLVSDRRMKCNVKPVANLYQY---RYLSDPKNVQRIGVIAQEISKIRPDTV 119
                      +SD  +K N+  V     Y    +     + +  GV+AQ++ ++ PD V
Sbjct: 276 -----------LSDVNVKENIVLVGEKNGYPLYEFNYKGNSQRYRGVLAQDLVRLNPDAV 324

Query: 120 VEN-NQGIKSVDYGRL 134
             N    +  V+Y +L
Sbjct: 325 YMNIKTHLLHVNYNKL 340


>gi|270008766|gb|EFA05214.1| hypothetical protein TcasGA2_TC015354 [Tribolium castaneum]
          Length = 984

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 39/132 (29%), Gaps = 28/132 (21%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQY 92
             +  +  ++  +  +                 SD R K N+         + V  L   
Sbjct: 457 IFHNGKVGINTDRPDESLVVHGNIKVTGHIIQPSDIRAKKNIVECDTAEQLRNVQKLRVV 516

Query: 93  RYLSDPK---------NVQRIGVIAQEISKIRPDTVVENN----------QGIKSVDYGR 133
           RY  +P               GVIAQE++KI P+ V                   V+  R
Sbjct: 517 RYDYEPSFASQLSRDSQHSDTGVIAQEVAKILPEAVRPAGDLVLKNGQSIDNFLVVNKER 576

Query: 134 LFNIGQIQTKQK 145
           +F       K+ 
Sbjct: 577 IFMENIGAVKEL 588


>gi|91084207|ref|XP_968063.1| PREDICTED: similar to CG3328 CG3328-PA [Tribolium castaneum]
          Length = 990

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 39/132 (29%), Gaps = 28/132 (21%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQY 92
             +  +  ++  +  +                 SD R K N+         + V  L   
Sbjct: 457 IFHNGKVGINTDRPDESLVVHGNIKVTGHIIQPSDIRAKKNIVECDTAEQLRNVQKLRVV 516

Query: 93  RYLSDPK---------NVQRIGVIAQEISKIRPDTVVENN----------QGIKSVDYGR 133
           RY  +P               GVIAQE++KI P+ V                   V+  R
Sbjct: 517 RYDYEPSFASQLSRDSQHSDTGVIAQEVAKILPEAVRPAGDLVLKNGQSIDNFLVVNKER 576

Query: 134 LFNIGQIQTKQK 145
           +F       K+ 
Sbjct: 577 IFMENIGAVKEL 588


>gi|291568496|dbj|BAI90768.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 238

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 40/146 (27%), Gaps = 28/146 (19%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
                Y   +  +  +++  R          +N         SD + K  +         
Sbjct: 83  YNGQTYFIKSSTLSSSRVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSE 142

Query: 86  VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
           +  L    +  +          + ++ G+IAQE+  I P+ V                  
Sbjct: 143 INALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVIKNDHTDSPEVDDKKI 202

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 203 DYLTIMYDKLIPLVIAAIQELSEKID 228


>gi|296487696|gb|DAA29809.1| hypothetical protein LOC781109 [Bos taurus]
          Length = 896

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K NV+          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 448 PSDSRAKQNVQEVDTNEQLRRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVREILP 507

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 508 RAVREVGDVTCENGETLENFLMVDKDQIFMENVGAVKQL 546


>gi|156121291|ref|NP_001095793.1| hypothetical protein LOC781109 [Bos taurus]
 gi|151553530|gb|AAI48935.1| MGC139000 protein [Bos taurus]
          Length = 896

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K NV+          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 448 PSDSRAKQNVQEVDTNEQLRRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEVREILP 507

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 508 RAVREVGDVTCENGETLENFLMVDKDQIFMENVGAVKQL 546


>gi|327393430|dbj|BAK10852.1| hypothetical protein PAJ_0772 [Pantoea ananatis AJ13355]
          Length = 425

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 24/67 (35%), Gaps = 7/67 (10%)

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVA-------NLYQYRYLSDPKNVQRIGVIAQEISK 113
             +          +SD+R+K  ++ +         +    +         IG IAQ++  
Sbjct: 296 NGSYYAYNGSFQSLSDKRIKDEIETIKDPLAKMKQISGVTFRRRDTGNWGIGFIAQDVET 355

Query: 114 IRPDTVV 120
           + P+ V 
Sbjct: 356 VFPEAVS 362


>gi|332839997|ref|XP_522467.3| PREDICTED: myelin gene regulatory factor-like [Pan troglodytes]
          Length = 796

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 361 PSDSRAKQNIQEVDTNEQLKRIAQMRIVEYDYKPEFASAMGINTAHQTGMIAQEMQEILP 420

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 421 RAVREVGDVTCGNGETLENFLMVDKDQIFMENVGAVKQL 459


>gi|291566481|dbj|BAI88753.1| hypothetical protein [Arthrospira platensis NIES-39]
 gi|291567231|dbj|BAI89503.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 238

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/146 (12%), Positives = 40/146 (27%), Gaps = 30/146 (20%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------V 86
               +   +     +++  R          +N         SD + K  +         +
Sbjct: 84  GQTYFTKSSTLSSSSEVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSEI 143

Query: 87  ANLYQ--YRYL-------SDPKNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
             L    ++Y         +P    + G+IAQE+  I P+ V                  
Sbjct: 144 NALTVTWFKYNELAAFHGFNPSTE-QFGLIAQEVQNIYPNAVEVVKNDHTDSPEVDDKKI 202

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 203 DYLTIMYDKLIPLVIAAIQELSEKID 228


>gi|307138020|ref|ZP_07497376.1| hypothetical protein EcolH7_07791 [Escherichia coli H736]
          Length = 876

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/158 (13%), Positives = 47/158 (29%), Gaps = 28/158 (17%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +    L    +   + I +   +    +   G +        +++    + F     +  
Sbjct: 669 NRFALLNSGNSELPVGIRVWGSSTRQNVFEVGTSTAYLFY--AQKTSAGQLFDVNGAINC 726

Query: 69  QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV- 120
                 SDR +K ++  +++       +  Y Y      +   GVIAQE+ +  P+ V  
Sbjct: 727 TTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPYAGVIAQEVMEAIPEAVGS 786

Query: 121 ------------------ENNQGIKSVDYGRLFNIGQI 140
                                    +VDY  +  +   
Sbjct: 787 FTHYGEELQGPTVDGNELREETRYLNVDYAAVTGLLVQ 824


>gi|238695132|ref|YP_002922326.1| large distal tail fiber subunit [Enterobacteria phage JSE]
 gi|220029268|gb|ACL78203.1| large distal tail fiber subunit [Enterobacteria phage JSE]
          Length = 969

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/161 (13%), Positives = 49/161 (30%), Gaps = 22/161 (13%)

Query: 6   QAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVN 65
           Q+ +   ++ +     +  I+              IA+    +   +      +     N
Sbjct: 793 QSTNSAHNIWKATHWGQYHIAAMGVHVPNGTIGDAIARLNVHDANFDFS-ASGDMSAGRN 851

Query: 66  MGYQLAPLVSDRRMKCN--------VKPVANLYQYRYLSDPKNV------QRIGVIAQEI 111
             +    + SD R+K N           V  L  Y Y               +G+IAQ++
Sbjct: 852 GSFNDVYIRSDARLKINKEEYKENATDKVNRLTVYTYDKVKSLTDRSVIAHEVGIIAQDL 911

Query: 112 SKIRPDTVVEN-------NQGIKSVDYGRLFNIGQIQTKQK 145
            K  P+ V  +        + I ++    +  +     ++ 
Sbjct: 912 EKELPEAVTTSKVGDPDKPEEILTISNSAVNALLIKAFQEM 952


>gi|331641942|ref|ZP_08343077.1| L-shaped tail fiber protein (Protein ltf) [Escherichia coli H736]
 gi|331038740|gb|EGI10960.1| L-shaped tail fiber protein (Protein ltf) [Escherichia coli H736]
          Length = 1114

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/158 (13%), Positives = 47/158 (29%), Gaps = 28/158 (17%)

Query: 9    HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
            +    L    +   + I +   +    +   G +        +++    + F     +  
Sbjct: 907  NRFALLNSGNSELPVGIRVWGSSTRQNVFEVGTSTAYLFY--AQKTSAGQLFDVNGAINC 964

Query: 69   QLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV- 120
                  SDR +K ++  +++       +  Y Y      +   GVIAQE+ +  P+ V  
Sbjct: 965  TTLNQSSDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPYAGVIAQEVMEAIPEAVGS 1024

Query: 121  ------------------ENNQGIKSVDYGRLFNIGQI 140
                                     +VDY  +  +   
Sbjct: 1025 FTHYGEELQGPTVDGNELREETRYLNVDYAAVTGLLVQ 1062


>gi|301616480|ref|XP_002937694.1| PREDICTED: myelin gene regulatory factor-like [Xenopus (Silurana)
           tropicalis]
          Length = 1166

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 34/100 (34%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKC---------NVKPVANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K           +K ++ +    Y   P+         N    GVIAQE+ +I 
Sbjct: 635 PSDIRAKESVEEVDTTEQLKRISQMRLVHYHYKPEFASTVGLDENAAETGVIAQEVQEIL 694

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           PD V E+                V+  R+F       K+ 
Sbjct: 695 PDAVKESGDLVCANGATIENFLVVNKERIFMENVGAVKEL 734


>gi|291389555|ref|XP_002711300.1| PREDICTED: myelin gene regulatory factor-like [Oryctolagus
           cuniculus]
          Length = 924

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 33/99 (33%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K NV+          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 464 PSDSRAKQNVQEVDTNEQLRRIAQMRIVEYEYKPEFASAMGINTAHQTGMIAQEVQEILP 523

Query: 117 DTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
             V E        G        VD  ++F       KQ 
Sbjct: 524 GAVREVGSVTCENGETLENFLMVDKDQIFMENVGAVKQL 562


>gi|327409972|ref|YP_004347392.1| hypothetical protein LAU_0430 [Lausannevirus]
 gi|326785146|gb|AEA07280.1| conserved hypothetical protein [Lausannevirus]
          Length = 382

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/141 (12%), Positives = 37/141 (26%), Gaps = 8/141 (5%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +         +       +            L                   +    S 
Sbjct: 238 GTSGTNRIALGASAVCSVDNEMTIAPTITQWRSLGLSSAAAANTLQINPATGIITQAASS 297

Query: 77  RRMKCN-------VKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGI-KS 128
           RR K N        + +  L    Y       +  G+IA+E  ++ PD V  + +G    
Sbjct: 298 RRFKDNIRELEVDPRMLHELSLKTYNYKKDGEKDHGLIAEEAFEVLPDIVTLDAEGKPHG 357

Query: 129 VDYGRLFNIGQIQTKQKKNTA 149
           + +  L  +   + ++ +   
Sbjct: 358 IKHLTLAMLLLAEVQRLEKEV 378


>gi|149066917|gb|EDM16650.1| rCG49167, isoform CRA_b [Rattus norvegicus]
          Length = 300

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 35/99 (35%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K NV+          +A +   +Y   P            + G+IAQE+ +I P
Sbjct: 159 PSDIRVKENVQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGIDTAHQTGMIAQEVQEILP 218

Query: 117 DTVVENN----------QGIKSVDYGRLFNIGQIQTKQK 145
             V E            +    VD  ++F       KQ 
Sbjct: 219 RAVREVGGVTCGNGETLENFLMVDKDQIFMENVGAVKQL 257


>gi|155122204|gb|ABT14072.1| hypothetical protein MT325_M518L [Paramecium bursaria chlorella virus
            MT325]
          Length = 1189

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 36/116 (31%), Gaps = 13/116 (11%)

Query: 21   PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
                + +   +     +      N                  A   G  L    SDRR+K
Sbjct: 1031 NNDAVIIGQNSTAINQNNLVSLCNNDNFVTLATNGDFTVPGAAFKPGGGLWTATSDRRLK 1090

Query: 81   CNVKPVA-----------NLYQYRYLS--DPKNVQRIGVIAQEISKIRPDTVVENN 123
             ++               +L ++ +       +  ++G IAQE+ ++ P  VVE  
Sbjct: 1091 NDITTANIDRCEEIVRSLDLKKFTWADQVRENDRNQLGWIAQEVEEVFPKAVVEKE 1146


>gi|300907921|ref|ZP_07125524.1| hypothetical protein HMPREF9536_05826 [Escherichia coli MS 84-1]
 gi|300400383|gb|EFJ83921.1| hypothetical protein HMPREF9536_05826 [Escherichia coli MS 84-1]
          Length = 480

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 48/149 (32%), Gaps = 26/149 (17%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
           +QN    +LP S+         +   +  +      +++    + F     +        
Sbjct: 332 LQNSGNAELPFSVRVWGSSTRQNVFEVGTSAAYLFYAQKTSAGQLFDVNGAINCTTLNQS 391

Query: 75  SDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV------- 120
           SDR +K ++  +++       +  Y Y      +   GVIAQE+ +  P+ V        
Sbjct: 392 SDRDLKDDILVISDATKAIRKMNGYTYTLRENGMPYAGVIAQEVMEAIPEAVGSFTHYGE 451

Query: 121 ------------ENNQGIKSVDYGRLFNI 137
                              +VDY  +  +
Sbjct: 452 ELQGPTVDGNELREETRYLNVDYAAVTGL 480


>gi|332705214|ref|ZP_08425295.1| hypothetical protein LYNGBM3L_03900 [Lyngbya majuscula 3L]
 gi|332355957|gb|EGJ35416.1| hypothetical protein LYNGBM3L_03900 [Lyngbya majuscula 3L]
          Length = 1135

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 48/150 (32%), Gaps = 21/150 (14%)

Query: 12   LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
                          +       A +       +  +   +   EG        ++ Y+  
Sbjct: 976  TGGPSGTRFGVYGRADAQNNSSAIVYGVYGVASGGKTSYAGYFEGNVHVNG--HLTYRTI 1033

Query: 72   PLVSDRRMKCNVKPV---------ANLYQ--YRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
              VS R +K N+  +           L    + Y  D +    IG IA+++    PD V 
Sbjct: 1034 GQVSSRELKENINTLAIEDAIETLEGLNPVQFSYKKDHQKETHIGFIAEDV----PDLVA 1089

Query: 121  ENNQGIKS-VDYGRLFNIGQIQTKQKKNTA 149
             +++   S +D   +  +     K++ NT 
Sbjct: 1090 SHDRKTLSPMD---IVAVLTKVVKEQNNTI 1116


>gi|148689861|gb|EDL21808.1| mCG125060 [Mus musculus]
          Length = 353

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 34/99 (34%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R+K N++          +A +   +Y   P            + G+IAQE+ +I P
Sbjct: 214 PSDSRVKENIQEVDTNEQLRRIAQMRIVQYDYKPEFASAMGINTAHQTGMIAQEVQEILP 273

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 274 RAVREVGDVTGGNGETLENFLMVDKDQIFMENVGAVKQL 312


>gi|291569420|dbj|BAI91692.1| hypothetical protein [Arthrospira platensis NIES-39]
 gi|291570653|dbj|BAI92925.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 238

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/145 (11%), Positives = 38/145 (26%), Gaps = 28/145 (19%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------V 86
               +   +     + +  R          +N         SD + K  +         +
Sbjct: 84  GQTYFTKSSTLSSSSGVHTRFRVGDTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSEI 143

Query: 87  ANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------- 125
             L    +  +          + ++ G+IAQE+  I P+ V                   
Sbjct: 144 NALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVVKNDHTDSPEVDDKKID 203

Query: 126 IKSVDYGRLFNIGQIQTKQKKNTAQ 150
             ++ Y +L  +     ++      
Sbjct: 204 YLTIMYDKLIPLVIAAIQELSEKID 228


>gi|332249744|ref|XP_003274019.1| PREDICTED: myelin gene regulatory factor-like [Nomascus leucogenys]
          Length = 1484

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74   VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
             SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 919  PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 978

Query: 116  PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
            P+ V +                 V+  R+F       K+ 
Sbjct: 979  PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 1018


>gi|301781706|ref|XP_002926264.1| PREDICTED: LOW QUALITY PROTEIN: myelin gene regulatory factor-like
           [Ailuropoda melanoleuca]
          Length = 1126

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 556 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAATAGIEATAPETGVIAQEVKEIL 615

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 616 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 655


>gi|293344607|ref|XP_001074493.2| PREDICTED: similar to KIAA0954 protein [Rattus norvegicus]
 gi|293356414|ref|XP_215195.5| PREDICTED: myelin gene regulatory factor [Rattus norvegicus]
          Length = 1112

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 576 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 635

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 636 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 675


>gi|291409584|ref|XP_002721066.1| PREDICTED: myelin gene regulatory factor [Oryctolagus cuniculus]
          Length = 1109

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 575 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 634

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 635 PEAVKDTGDMVFANGNTIENFLVVNKERIFMENVGAVKEL 674


>gi|282165688|ref|NP_001163958.1| myelin gene regulatory factor [Rattus norvegicus]
          Length = 1142

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 585 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 644

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 645 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 684


>gi|242247266|ref|NP_001028653.1| myelin gene regulatory factor [Mus musculus]
          Length = 1112

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 586 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 645

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 646 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 685


>gi|187957324|gb|AAI57943.1| Gm98 protein [Mus musculus]
          Length = 937

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 384 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 443

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 444 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 483


>gi|172044633|sp|Q3UR85|MRF_MOUSE RecName: Full=Myelin gene regulatory factor
          Length = 1138

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 586 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 645

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 646 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 685


>gi|149062373|gb|EDM12796.1| similar to KIAA0954 protein (predicted) [Rattus norvegicus]
          Length = 437

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 98  PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 157

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 158 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 197


>gi|148709399|gb|EDL41345.1| mCG118536 [Mus musculus]
          Length = 807

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 468 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 527

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 528 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 567


>gi|119594370|gb|EAW73964.1| chromosome 11 open reading frame 9, isoform CRA_b [Homo sapiens]
          Length = 1109

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 575 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 634

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 635 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 674


>gi|119594373|gb|EAW73967.1| chromosome 11 open reading frame 9, isoform CRA_e [Homo sapiens]
          Length = 632

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 98  PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 157

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 158 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 197


>gi|188528652|ref|NP_001120864.1| myelin gene regulatory factor isoform 2 [Homo sapiens]
 gi|182637560|sp|Q9Y2G1|MRF_HUMAN RecName: Full=Myelin gene regulatory factor
 gi|119594372|gb|EAW73966.1| chromosome 11 open reading frame 9, isoform CRA_d [Homo sapiens]
 gi|168278769|dbj|BAG11264.1| C11orf9 protein [synthetic construct]
          Length = 1151

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 586 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 645

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 646 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 685


>gi|119594369|gb|EAW73963.1| chromosome 11 open reading frame 9, isoform CRA_a [Homo sapiens]
          Length = 663

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 98  PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 157

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 158 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 197


>gi|302565272|ref|NP_001181647.1| myelin gene regulatory factor [Macaca mulatta]
          Length = 1111

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 577 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 636

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 637 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 676


>gi|109105805|ref|XP_001116657.1| PREDICTED: myelin gene regulatory factor-like isoform 1 [Macaca
           mulatta]
          Length = 1151

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 586 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 645

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 646 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 685


>gi|73983492|ref|XP_867880.1| PREDICTED: similar to CG3328-PA isoform 2 [Canis familiaris]
          Length = 1116

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 582 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAATAGIEATAPETGVIAQEVKEIL 641

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 642 PEAVKDTGDMVFANGQTVENFLVVNKERIFMENVGAVKEL 681


>gi|73983494|ref|XP_540915.2| PREDICTED: similar to CG3328-PA isoform 1 [Canis familiaris]
          Length = 1147

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 582 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAATAGIEATAPETGVIAQEVKEIL 641

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 642 PEAVKDTGDMVFANGQTVENFLVVNKERIFMENVGAVKEL 681


>gi|7019335|ref|NP_037411.1| myelin gene regulatory factor isoform 1 [Homo sapiens]
 gi|6808502|gb|AAF28400.1|AF086762_1 C11orf9 [Homo sapiens]
 gi|119594374|gb|EAW73968.1| chromosome 11 open reading frame 9, isoform CRA_f [Homo sapiens]
 gi|157169576|gb|AAI52732.1| Chromosome 11 open reading frame 9 [synthetic construct]
 gi|162319074|gb|AAI56715.1| Chromosome 11 open reading frame 9 [synthetic construct]
          Length = 1111

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 577 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 636

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 637 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 676


>gi|74200893|dbj|BAE24803.1| unnamed protein product [Mus musculus]
          Length = 779

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 586 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 645

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 646 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 685


>gi|74187068|dbj|BAE20548.1| unnamed protein product [Mus musculus]
          Length = 614

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 62  PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 121

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 122 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 161


>gi|20521708|dbj|BAA76798.2| KIAA0954 protein [Homo sapiens]
          Length = 1183

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 618 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 677

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 678 PEAVKDTGDMVFANGKTIENFLVVNKERIFMENVGAVKEL 717


>gi|73968742|ref|XP_538281.2| PREDICTED: similar to CG3328-PA [Canis familiaris]
          Length = 1158

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K N++          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 468 PSDSRAKQNIQEVDTNEQLRRIAQMRIVEYDYRPEFASSMGINTAHQTGMIAQEVQEILP 527

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 528 RAVREVGDVTCENGETLQNFLMVDKDQIFMENVGAVKQL 566


>gi|297492043|ref|XP_002699358.1| PREDICTED: myelin gene regulatory factor-like [Bos taurus]
 gi|296471698|gb|DAA13813.1| myelin gene regulatory factor-like [Bos taurus]
          Length = 1270

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 705 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAATAGIEAAAPETGVIAQEVKEIL 764

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 765 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 804


>gi|194679613|ref|XP_586725.4| PREDICTED: myelin gene regulatory factor [Bos taurus]
          Length = 1262

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 724 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAATAGIEAAAPETGVIAQEVKEIL 783

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 784 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 823


>gi|297688508|ref|XP_002821735.1| PREDICTED: myelin gene regulatory factor-like [Pongo abelii]
          Length = 1344

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 779 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIAATAPETGVIAQEVKEIL 838

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 839 PEAVKDTGDMIFANGKTIENFLVVNKERIFMENVGAVKEL 878


>gi|307308706|ref|ZP_07588402.1| hypothetical protein SinmeBDRAFT_4298 [Sinorhizobium meliloti
           BL225C]
 gi|306900712|gb|EFN31323.1| hypothetical protein SinmeBDRAFT_4298 [Sinorhizobium meliloti
           BL225C]
          Length = 604

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 31/140 (22%), Gaps = 25/140 (17%)

Query: 11  ILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQ---NIYQNQLSERKEGKKEFYDAVNMG 67
           I   +         IS           Y    Q              +       +V   
Sbjct: 341 IDPTVVGSEFGLEVISSTGRMRRRVNGYNPFQQSRMGTAGALQEFFMDTASVGSISVTAT 400

Query: 68  YQLAPLVSDRRMKCNVKP--------------------VANLYQYRYLS--DPKNVQRIG 105
                  SD R+K +V P                    V       Y    DP +    G
Sbjct: 401 ATNYATSSDYRLKTSVFPLVEFSLTQEQFDLLDDTLLRVMCYRPVSYKWLNDPASGLAHG 460

Query: 106 VIAQEISKIRPDTVVENNQG 125
            IA E+  + P  V     G
Sbjct: 461 FIAHELQDVAPHAVTGLKDG 480


>gi|15613525|ref|NP_241828.1| hypothetical protein BH0962 [Bacillus halodurans C-125]
 gi|10173577|dbj|BAB04681.1| BH0962 [Bacillus halodurans C-125]
          Length = 1326

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/141 (12%), Positives = 41/141 (29%), Gaps = 17/141 (12%)

Query: 22   KLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRM 79
             + +S ++         A     +  +                   +        SD ++
Sbjct: 1156 GINVSFSDWNYNLGTSSAPWNFGRINHLRPSGSSHSVGSFSERYNFVYTNTLVEGSDIKI 1215

Query: 80   KCNVKP-------VANLYQYRYLSDPKNVQRIGVIAQEISKIR--------PDTVVENNQ 124
            K ++K        + +L    +        + G+IAQE++             T+V  N 
Sbjct: 1216 KSDIKNSFLGLAFIKDLRPVDFQLVENEQYKTGLIAQEVAAELEHHGIDLEKQTIVTIND 1275

Query: 125  GIKSVDYGRLFNIGQIQTKQK 145
             +  V Y +L        ++ 
Sbjct: 1276 SVMGVSYTQLIAPTIKAIQEL 1296


>gi|326431896|gb|EGD77466.1| hypothetical protein PTSG_08561 [Salpingoeca sp. ATCC 50818]
          Length = 1363

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 35/106 (33%), Gaps = 29/106 (27%)

Query: 74  VSDRRMKCNVK---------PVANLYQYRYLSDP----------KNVQRIGVIAQEISKI 114
            SD+R+K N+           V  +  Y Y               +   +GV+AQE+ ++
Sbjct: 824 TSDKRVKENIHAASTKRHLDNVNRMTLYEYDLKEEWARKAGRSSDDRHEMGVVAQELQQV 883

Query: 115 RPDTVV----------ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            PD V                +  V+  R+F       ++     Q
Sbjct: 884 LPDAVQSCGDVALDDGTEIDDLLVVNKDRVFMESVGAVQELSKMTQ 929


>gi|323947373|gb|EGB43379.1| hypothetical protein EREG_01110 [Escherichia coli H120]
          Length = 1178

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 47/121 (38%), Gaps = 21/121 (17%)

Query: 46   YQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN--------VKPVANLYQYRYL-- 95
            + +  +       +F    N  +    + SD R+K N        ++ V +L  Y Y   
Sbjct: 1033 HVHDATFDFNAAGDFTAGRNGSFNDVYIRSDSRLKINKEELQDGALEKVNSLKVYTYDKV 1092

Query: 96   ----SDPKNVQRIGVIAQEISKIRPDTVV-------ENNQGIKSVDYGRLFNIGQIQTKQ 144
                 D    + +G+IAQ++ K+ P+ V        E+ + IK++    +  +     ++
Sbjct: 1093 KSLSDDTVIKREVGIIAQDLEKVLPEAVGIQSTEDPEHPEAIKTISNSAVNALIIKAMQE 1152

Query: 145  K 145
             
Sbjct: 1153 M 1153


>gi|307106860|gb|EFN55105.1| hypothetical protein CHLNCDRAFT_135022 [Chlorella variabilis]
          Length = 1151

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 22/67 (32%), Gaps = 6/67 (8%)

Query: 86  VANLYQYRYLS--DPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTK 143
           +  L    Y    DP   +  G +AQE+       V E   G   V   +L        K
Sbjct: 422 ICRLNAVEYCWASDPGGQRIAGFLAQEMK----GAVHEAEDGTLFVAITKLLPYAAAAIK 477

Query: 144 QKKNTAQ 150
           + +   +
Sbjct: 478 ELETRLE 484


>gi|307209791|gb|EFN86596.1| Uncharacterized protein C11orf9-like protein [Harpegnathos
           saltator]
          Length = 933

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 34/100 (34%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKPVA---------NLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K NV+ V           L   RY   P+           +  GVIAQE+ +I 
Sbjct: 325 PSDARAKQNVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLDVKQEDTGVIAQEVQQIL 384

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V+                  V+  R+F       K+ 
Sbjct: 385 PEAVLPAGDIVLPNGQRIENFLVVNKERIFMENVGAVKEL 424


>gi|155370623|ref|YP_001426157.1| hypothetical protein FR483_N525L [Paramecium bursaria Chlorella virus
            FR483]
 gi|155123943|gb|ABT15810.1| hypothetical protein FR483_N525L [Paramecium bursaria Chlorella virus
            FR483]
          Length = 1321

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 36/116 (31%), Gaps = 13/116 (11%)

Query: 21   PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
                + +   +     +      N                  A   G  L    SDRR+K
Sbjct: 1163 NNDAVIIGQNSTAINQNNLVSLCNNDNFVTLATNGDFTVPGAAFKPGGGLWTATSDRRLK 1222

Query: 81   CNVKPVA-----------NLYQYRYLS--DPKNVQRIGVIAQEISKIRPDTVVENN 123
             ++               +L ++ +       +  ++G IAQE+ ++ P  VVE  
Sbjct: 1223 NDITTANIDRCEEIVRSLDLKKFTWADQVRENDRNQLGWIAQEVEEVFPKAVVEKE 1278


>gi|307181498|gb|EFN69086.1| Uncharacterized protein C11orf9-like protein [Camponotus
           floridanus]
          Length = 1194

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 34/100 (34%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKPVA---------NLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K NV+ V           L   RY   P+           +  GVIAQE+ +I 
Sbjct: 559 PSDARAKQNVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLDVKQEDTGVIAQEVQQIL 618

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V+                  V+  R+F       K+ 
Sbjct: 619 PEAVLPAGDIVLPNGQRIENFLVVNKERIFMENVGAVKEL 658


>gi|170680068|ref|YP_001743939.1| hypothetical protein EcSMS35_1885 [Escherichia coli SMS-3-5]
 gi|170517786|gb|ACB15964.1| hypothetical protein EcSMS35_1885 [Escherichia coli SMS-3-5]
          Length = 88

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 23/73 (31%), Gaps = 11/73 (15%)

Query: 86  VANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQ----------GIKSVD-YGRL 134
           +  L    +         IG IAQ++ KI P  V E             G+ S D YG  
Sbjct: 1   MEMLKGCSWTRKDTGQWGIGFIAQDVKKIFPQAVTEGGDRQLPDGTMVEGVLSPDTYGVA 60

Query: 135 FNIGQIQTKQKKN 147
             +         N
Sbjct: 61  AALHHEAILALMN 73


>gi|311743653|ref|ZP_07717459.1| conserved hypothetical protein [Aeromicrobium marinum DSM 15272]
 gi|311312783|gb|EFQ82694.1| conserved hypothetical protein [Aeromicrobium marinum DSM 15272]
          Length = 316

 Score = 45.1 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/141 (17%), Positives = 44/141 (31%), Gaps = 15/141 (10%)

Query: 20  VPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRM 79
           V     +      +A       A ++    L     G       V   + +A + S  R 
Sbjct: 158 VQNAGGTRVGTLSLAAARVDIDANHLGLYSLPTTSSGANLHLGTVGGQFTVALVTSSERY 217

Query: 80  KCNVKPV---------ANLYQYRYLSD-----PKNVQRIGVIAQEISKIRPDTVVENNQG 125
           K ++                 +R   D         + +G IA+EI    P+ V  +++G
Sbjct: 218 KQDIADAEIDPDAVLRWVPRTWRDKHDVAAVGDDAAEHVGFIAEEIHAETPEFVNLDDEG 277

Query: 126 I-KSVDYGRLFNIGQIQTKQK 145
              S+ Y R+        K +
Sbjct: 278 RPDSLKYDRMVAGLHAVVKAQ 298


>gi|149632301|ref|XP_001512136.1| PREDICTED: similar to chromosome 12 open reading frame 28
           [Ornithorhynchus anatinus]
          Length = 826

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 35/105 (33%), Gaps = 27/105 (25%)

Query: 68  YQLAPLVSDRRMKCNVKP---------VANLYQYRYLSDPK--------NVQRIGVIAQE 110
                  SD R K N++          +A +    Y   P+        +V + G+IAQE
Sbjct: 389 SGAVLYPSDSRAKQNIQEVDPNEQLRRIAQMRVVEYDYKPEFASVMGIEHVHQTGMIAQE 448

Query: 111 ISKIRPDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           +  I P  V E              +  VD  ++F       KQ 
Sbjct: 449 VKDILPSAVREVGDVTCANGEKVENLLVVDKDQIFMENVGAVKQL 493


>gi|328785444|ref|XP_393650.4| PREDICTED: myelin gene regulatory factor-like [Apis mellifera]
          Length = 1139

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 34/101 (33%), Gaps = 29/101 (28%)

Query: 74  VSDRRMKCNVKPVA---------NLYQYRYLSDPK----------NVQRIGVIAQEISKI 114
            SD R K NV+ V           L   RY   P+            +  GVIAQE+ +I
Sbjct: 531 PSDARAKQNVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLGIKQQEDTGVIAQEVQQI 590

Query: 115 RPDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
            P+ V+                  V+  R+F       K+ 
Sbjct: 591 LPEAVLPAGDIVLPNGQRIENFLMVNKERIFMENVGAVKEL 631


>gi|47210713|emb|CAF90005.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 974

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 27/68 (39%), Gaps = 17/68 (25%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD+R KCN++          +  +    +   P         +  + GV+AQE+ ++ P
Sbjct: 575 PSDQRAKCNIQEVDSEQQLKRINQMRIVEFDYKPEFASSLGIDHTHQTGVLAQEVKELLP 634

Query: 117 DTVVENNQ 124
             V +   
Sbjct: 635 SAVTQVGD 642


>gi|194228569|ref|XP_001494410.2| PREDICTED: similar to Uncharacterized protein C12orf28, partial
           [Equus caballus]
          Length = 504

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SD R K NV+          +A +    Y   P            + G+IAQE+ +I P
Sbjct: 56  PSDSRAKQNVQEVDTNEQLRRIAQMRIVEYDYKPEFASAMGINAAHQTGMIAQEVREILP 115

Query: 117 DTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 116 AAVREVGDVTCENGETLEHFLMVDKDQIFMENVGAVKQL 154


>gi|319406190|emb|CBI79827.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 371

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/138 (15%), Positives = 49/138 (35%), Gaps = 19/138 (13%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           ++Q  +A++++  L+    +                    I ++  ++        K   
Sbjct: 218 LEQDNKAWNQLERLL---QIGTKAAGNYGTKTGEATTMPAITKDPLRDAQRVLGLLKGII 274

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQY---RYLSDPKNVQRIGVIAQEISKIRPD 117
                        +SD  +K N+  V     Y    +     + +  GV+AQ++ ++ PD
Sbjct: 275 G------------LSDVNVKENIVLVGEKKGYPLYEFNYKGNSQRYRGVLAQDLIRLNPD 322

Query: 118 TVVEN-NQGIKSVDYGRL 134
            V  N    +  V+Y +L
Sbjct: 323 AVYMNIKTHLLHVNYNKL 340


>gi|321464079|gb|EFX75090.1| hypothetical protein DAPPUDRAFT_306915 [Daphnia pulex]
          Length = 1243

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 29/101 (28%), Gaps = 29/101 (28%)

Query: 74  VSDRR---------MKCNVKPVANLYQYRYLS----------DPKNVQRIGVIAQEISKI 114
            SDRR          K  ++ V  L    Y                    GVIAQE+  I
Sbjct: 650 PSDRRAKEGIEEADTKEQLRNVQALRVVHYKYTEEFAETAGLKEDERGDTGVIAQEVESI 709

Query: 115 RPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
            PD V          G        V+  R+F       K+ 
Sbjct: 710 IPDAVRPAGNIVLPNGRQIENFLVVNKERIFMENVGAVKEL 750


>gi|326680883|ref|XP_002667695.2| PREDICTED: myelin gene regulatory factor-like, partial [Danio
           rerio]
          Length = 833

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 32/99 (32%), Gaps = 27/99 (27%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRP 116
            SDRR K N++          +A +    Y   P              G+IAQE+ ++ P
Sbjct: 492 PSDRRAKQNIQEVDSTEQLKRIAQMRIVEYDYRPEFASRMGIDQCHETGIIAQEVRELLP 551

Query: 117 DTVVENN----------QGIKSVDYGRLFNIGQIQTKQK 145
             V E                 VD  ++F       KQ 
Sbjct: 552 SAVREMGDITCINGETIDQFLMVDKEQIFMENVGAVKQL 590


>gi|291571174|dbj|BAI93446.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 259

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/174 (11%), Positives = 43/174 (24%), Gaps = 30/174 (17%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
             A +         T    P++      I   +         ++Q   R          +
Sbjct: 78  NGAQNSFFEQKSTTTWGGTPVNATGK--IEYFNNTWQFSASIESQALARFRYGPTSIAYI 135

Query: 65  NMGYQLAPLVSDRRMKCNVKP-------VANLYQYRYLSDP--------KNVQRIGVIAQ 109
                     SD R K  +         +  L    +  +          + ++ G+IAQ
Sbjct: 136 ATNGNYVSGSSDIRFKTLLSKPTIGLSEINALTVTWFKYNELAAFHGFNPSTEQFGLIAQ 195

Query: 110 EISKIRPDTVVENNQ-------------GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           E+  I  + V                     ++ Y +L  +     ++      
Sbjct: 196 EVQNIYHNAVEVVENNHTDSPEVDDKKIDYLTIMYDKLIPLVIAAIQELSEKID 249


>gi|322789180|gb|EFZ14566.1| hypothetical protein SINV_11777 [Solenopsis invicta]
          Length = 1024

 Score = 43.9 bits (102), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMK---------CNVKPVANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K           ++ V  L   RY   P+           +  GVIAQE+ +I 
Sbjct: 500 PSDVRAKQSVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLDIKQEDTGVIAQEVQQIL 559

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V+                  V+  R+F       K+ 
Sbjct: 560 PEAVLPAGDIVLPNGQRIENFLVVNKERIFMENVGAVKEL 599


>gi|155371439|ref|YP_001426973.1| hypothetical protein ATCV1_Z492L [Acanthocystis turfacea Chlorella
            virus 1]
 gi|155124759|gb|ABT16626.1| hypothetical protein ATCV1_Z492L [Acanthocystis turfacea Chlorella
            virus 1]
          Length = 1301

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/109 (19%), Positives = 39/109 (35%), Gaps = 14/109 (12%)

Query: 29   NPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK-------- 80
            N T  +  +   +  N     L    +      +A   G       SDRR+K        
Sbjct: 1144 NTTIDSRSNQVIMVNNGQVFSLFSNGDVSMTGVNAFKPGGGSWTATSDRRLKNDITLANS 1203

Query: 81   ---CNVKPVANLYQYRYLS---DPKNVQRIGVIAQEISKIRPDTVVENN 123
                N+     L ++ + +      +  +IG IAQ++ +  P +VV  +
Sbjct: 1204 IVCENLVRSLPLKRFTWDNMVPTGGDKNQIGFIAQDVEQFMPKSVVTRD 1252


>gi|332024497|gb|EGI64695.1| Myelin gene regulatory factor [Acromyrmex echinatior]
          Length = 1164

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMK---------CNVKPVANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K           ++ V  L   RY   P+           +  GVIAQE+ +I 
Sbjct: 554 PSDVRAKQSVQEVDTREQLRNVQQLRVVRYRYAPEFAQHSGLDIKQEDTGVIAQEVQQIL 613

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V+                  V+  R+F       K+ 
Sbjct: 614 PEAVLPAGDIVLPNGQRIENFLVVNKERIFMENVGAVKEL 653


>gi|311247514|ref|XP_003122692.1| PREDICTED: myelin gene regulatory factor-like [Sus scrofa]
          Length = 1169

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 33/100 (33%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 635 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAATAGIEAMAPETGVIAQEVKEIL 694

Query: 116 PDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           P+ V +                 V+  R+F       K+ 
Sbjct: 695 PEAVKDTGDVVFANGKTIENFLVVNKERIFMENVGAVKEL 734


>gi|291545443|emb|CBL18551.1| hypothetical protein CK1_01850 [Ruminococcus sp. SR1/5]
          Length = 412

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/160 (13%), Positives = 50/160 (31%), Gaps = 19/160 (11%)

Query: 10  EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ 69
           E  +        +   S++         ++G  +         R   + ++  +      
Sbjct: 239 ENQAKTSGKVKRQPVASVSADDSQVAYLFSGTGRKHGDAATYRRLGIRAKWGGSGFSTDY 298

Query: 70  LAPLV--SDRRMKCNVKPV----------ANLYQYRYLSDPKNVQR-IGVIAQEISKIRP 116
           L      SD R+K N++              + Q+ +        + IG +A E+ +I P
Sbjct: 299 LYTTSQVSDIRLKENIENSETDALETVNRMKVRQFDWKERMGGWHQNIGFVADELEEIDP 358

Query: 117 DTVVE---NNQG---IKSVDYGRLFNIGQIQTKQKKNTAQ 150
           +  +    +  G   IK ++   L N      ++      
Sbjct: 359 NLALGGGYDENGEMDIKQINSPYLLNYAIKAIQELSAKVD 398


>gi|301058752|ref|ZP_07199743.1| conserved domain protein [delta proteobacterium NaphS2]
 gi|300447165|gb|EFK10939.1| conserved domain protein [delta proteobacterium NaphS2]
          Length = 277

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/133 (12%), Positives = 40/133 (30%), Gaps = 18/133 (13%)

Query: 28  NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA 87
            +         A  +               +    A      +    S R  K ++K + 
Sbjct: 139 TSNAGNLKYRMAIDSVGYVGIGQRYPAYPLQMGSGAYVSSGGVWTNASSRAYKQDIKSLT 198

Query: 88  N---------LYQYRYLSDPK-NVQRIGVIAQEISKIRPDTV-VENNQGIKSVDYGRLFN 136
                     L   ++        + +G IA+++    PD V   + +G+ ++D   +  
Sbjct: 199 REEAEEALTALQPVQFSYKTNPKERHVGFIAEDV----PDLVASTDRKGMSAMD---VVA 251

Query: 137 IGQIQTKQKKNTA 149
           +     + ++ T 
Sbjct: 252 VLTKVVQDQQKTI 264


>gi|119474674|ref|ZP_01615027.1| Hep_Hag family protein [marine gamma proteobacterium HTCC2143]
 gi|119450877|gb|EAW32110.1| Hep_Hag family protein [marine gamma proteobacterium HTCC2143]
          Length = 596

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/162 (14%), Positives = 48/162 (29%), Gaps = 18/162 (11%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +     A     SL  NVT P            + +     A                  
Sbjct: 371 IGNSNTAI-GYGSLSNNVTGPGNTAIGAGANVASGVLTNTTAIGYGAVATVSDMVRIGNA 429

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVA-------NLYQYRY--LSDPKNVQRIGVIAQEI 111
             +V          SD R+K +++P+        +L    Y  +   +    +G +AQE+
Sbjct: 430 DVSVFETQLPWTTTSDERLKESIEPIDGGLSFVNDLNPVSYQRIGAKEKSTEMGFLAQEV 489

Query: 112 SKIR-------PDTVVE-NNQGIKSVDYGRLFNIGQIQTKQK 145
           + +           V + + + + ++ Y  L        ++ 
Sbjct: 490 AVVLEAHGLADSGLVHQSSPESMMTMRYNDLLAPMIKAIQEL 531


>gi|322510865|gb|ADX06179.1| putative tail fiber protein [Organic Lake phycodnavirus 1]
          Length = 205

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 41/119 (34%), Gaps = 10/119 (8%)

Query: 38  YAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------VANLY 90
            +          +S      ++      +  Q     SD R+K N++        +  + 
Sbjct: 79  GSPNVSLDASLNVSGNVYISEDLDVQGVVTAQSVTQTSDARLKTNIRDLSNGLDMIRQIQ 138

Query: 91  QYRYLSDPKNVQRIGVIAQEISKI--RPDTVVENN-QGIKSVDYGRLFNIGQIQTKQKK 146
              Y      ++ +GV+AQ+I  I      V  +    + +++Y  L+       ++ +
Sbjct: 139 PKLYNKKNSYLKEVGVLAQDILNIEGLEHLVRMDEKTQMYTMNYMGLYMYAIQAIQELE 197


>gi|167583570|ref|YP_001671760.1| tail fiber [Enterobacteria phage phiEco32]
 gi|164375408|gb|ABY52816.1| tail fiber [Enterobacteria phage phiEco32]
          Length = 722

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 21/148 (14%), Positives = 39/148 (26%), Gaps = 23/148 (15%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
             V    +S  +      +     +   Y              +    +        SD 
Sbjct: 574 SQVYDYDLSTGSQPNGDIVRNTYFSAESYDITFGNNSGTTNYIFSKSPV--------SDE 625

Query: 78  RMKCNVKPVANL-----------YQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN--- 123
           R+K ++K                  + Y  D K   R G IAQ++  I P  V +     
Sbjct: 626 RLKHSIKEEGTATALSNLNKMEYKTFIYNYDEKATVRRGFIAQQLEAIDPQYVRKYKTFK 685

Query: 124 -QGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                ++D   L        ++     +
Sbjct: 686 GTDTLALDENVLLLDAIAAIQELTKKVE 713


>gi|312599201|gb|ADQ91224.1| hypothetical protein BpV2_057 [Bathycoccus sp. RCC1105 virus BpV2]
          Length = 578

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 35/114 (30%), Gaps = 13/114 (11%)

Query: 20  VPKLPISLNNPTPIAPIDYAGIAQNI-YQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRR 78
                  +   +    I        I + +      E     Y   ++        SD R
Sbjct: 332 YSGFNKCIYYNSGSVGIGTTNPIYGILHVDGYVYYGEHYNSIYSEYSVLAGSYFTHSDSR 391

Query: 79  MKCNVKPVAN-----------LYQYRYLSDPKNVQRI-GVIAQEISKIRPDTVV 120
           +K NV  + +              Y Y+ + K    + G IAQ+++ + P  V 
Sbjct: 392 IKKNVTDINDSSALDKIRLLEPKIYNYIDEKKGTSNVYGFIAQQVANVLPHAVT 445


>gi|157311551|ref|YP_001469594.1| gp37 long tail fiber distal subunit [Enterobacteria phage Phi1]
 gi|149380755|gb|ABR24760.1| gp37 long tail fiber distal subunit [Enterobacteria phage Phi1]
          Length = 980

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 37/119 (31%), Gaps = 21/119 (17%)

Query: 48  NQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCN--------VKPVANLYQYRYLSDPK 99
           +  +       +     N  +    + SD R+K N           V  L  Y Y     
Sbjct: 845 HDANFDFSASGDMTIGRNGSFNDVYIRSDARLKINKEEYKENATDKVNRLTVYTYDKVKS 904

Query: 100 NV------QRIGVIAQEISKIRPDTVVE-------NNQGIKSVDYGRLFNIGQIQTKQK 145
                     +G+IAQ++ K  P+ V         N + I ++    +  +     ++ 
Sbjct: 905 LTDRTVIAHEVGIIAQDLEKELPEAVTTSKIGDPDNPEEILTISNSAVNALLIKAFQEM 963


>gi|298376103|ref|ZP_06986059.1| hypothetical protein HMPREF0104_02284 [Bacteroides sp. 3_1_19]
 gi|298267140|gb|EFI08797.1| hypothetical protein HMPREF0104_02284 [Bacteroides sp. 3_1_19]
          Length = 1014

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 48/135 (35%), Gaps = 22/135 (16%)

Query: 37   DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKC-------NVKPVANL 89
               G     +    +++ +        + +        SD R+K         +  +++L
Sbjct: 867  SQRGDKNVYFCWGGTDKNKASLSPTGNMYVAGN-YSNGSDIRLKERGINVSNVLDKISDL 925

Query: 90   YQYRYL--SDPKNVQRIGVIAQEISKIRPDTVVENN----QGIKSVDYGRL---FNI--- 137
              + +       +V RIGV AQ++ K+ P+ V   N      I +VDY  L     I   
Sbjct: 926  STFYHKRLDIGDDVTRIGVSAQDVQKVFPEVVGTANMPEYGDILTVDYATLATTVAINGC 985

Query: 138  --GQIQTKQKKNTAQ 150
                   K+++   +
Sbjct: 986  KELHQLIKEQQAKIE 1000


>gi|328870631|gb|EGG19004.1| NDT80/PhoG-like protein [Dictyostelium fasciculatum]
          Length = 1081

 Score = 42.8 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/147 (13%), Positives = 41/147 (27%), Gaps = 27/147 (18%)

Query: 31  TPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV------- 83
                 ++ G         ++  +  +                 SDRR+K ++       
Sbjct: 752 NGQWDQNHRGGIYRYGNVGINNAEPNEALSVHGNIAVTGTTYNPSDRRVKKDIKPVNTKE 811

Query: 84  --KPVANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQ--------- 124
             + +  L  Y Y               +  GV+AQE+ ++ P+ V E            
Sbjct: 812 QLEKIKKLQLYDYQLTDQWAKDTGITEKKERGVLAQELREVIPNAVKETGDRELSDGTVL 871

Query: 125 -GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                V+   +F      T++      
Sbjct: 872 KDFLMVNKDAIFMENVGATQELSKKVD 898


>gi|33620684|ref|NP_891822.1| large distal tail fiber subunit [Enterobacteria phage RB49]
 gi|33348151|gb|AAQ15494.1| large distal tail fiber subunit [Enterobacteria phage RB49]
          Length = 979

 Score = 42.8 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 24/161 (14%), Positives = 48/161 (29%), Gaps = 22/161 (13%)

Query: 6   QAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVN 65
           Q+     ++ +     K  I+              IA+    +   E      +     N
Sbjct: 803 QSTDSAHNIWKATHWGKYHIAAMGVHVPGGTIGNAIARLNVNDANFEFS-ASGDMSAGRN 861

Query: 66  MGYQLAPLVSDRRMKCN--------VKPVANLYQYRYLSDPKNV------QRIGVIAQEI 111
             +    + SD R+K N           V  L  Y Y               +G+IAQ++
Sbjct: 862 GSFNDVYIRSDARLKINKEEYKENATDKVNRLTVYTYDKVKSLTDRTVIAHEVGIIAQDL 921

Query: 112 SKIRPDTVVEN-------NQGIKSVDYGRLFNIGQIQTKQK 145
            K  P+ V  +        + I ++    +  +     ++ 
Sbjct: 922 EKELPEAVTTSKVGDPDKPEEILTISNSAVNALLIKAFQEM 962


>gi|315144242|gb|EFT88258.1| phage minor structural protein, region [Enterococcus faecalis
           TX2141]
          Length = 755

 Score = 42.8 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 45/157 (28%), Gaps = 24/157 (15%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
               V +  L +  +       I  + +       + +        FY  +NM       
Sbjct: 582 FDAGVQISNLNMGGSYVGGSGEIKNSTLVNTSVSTKFTVNNNVNLGFYSNLNMNGFSILN 641

Query: 74  VSDRRMKCNVKP--------VANLYQYRYLSD-----------PKNVQRIGVIAQEISKI 114
            SD R+K N+             L    +              P N + +G+IAQ     
Sbjct: 642 QSDVRLKENITDTKIDGIKETKKLNFVEFDRKQNYKSNNPIEQPSNKRELGLIAQ----Y 697

Query: 115 RPDT-VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P   V  N     S+D  +   +  +  KQ     +
Sbjct: 698 SPFLSVKHNEDHYLSLDMNKQVMLNSLTNKQLIEKIE 734


>gi|257422440|ref|ZP_05599430.1| predicted protein [Enterococcus faecalis X98]
 gi|257164264|gb|EEU94224.1| predicted protein [Enterococcus faecalis X98]
          Length = 755

 Score = 42.8 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 45/157 (28%), Gaps = 24/157 (15%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
               V +  L +  +       I  + +       + +        FY  +NM       
Sbjct: 582 FDAGVQISNLNMGGSYVGGSGEIKNSTLVNTSVSTKFTVNNNVNLGFYSNLNMNGFSILN 641

Query: 74  VSDRRMKCNVKP--------VANLYQYRYLSD-----------PKNVQRIGVIAQEISKI 114
            SD R+K N+             L    +              P N + +G+IAQ     
Sbjct: 642 QSDVRLKENITDTKIDGIKETKKLNFVEFDRKQNYKSNNPIEQPSNKRELGLIAQ----Y 697

Query: 115 RPDT-VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P   V  N     S+D  +   +  +  KQ     +
Sbjct: 698 SPFLSVKHNEDHYLSLDMNKQVMLNSLTNKQLIEKIE 734


>gi|156321247|ref|XP_001618234.1| hypothetical protein NEMVEDRAFT_v1g155251 [Nematostella vectensis]
 gi|156198133|gb|EDO26134.1| predicted protein [Nematostella vectensis]
          Length = 107

 Score = 42.8 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 17/65 (26%)

Query: 74  VSDRRMKCNVKPVA-----------NLYQYRYLSDP------KNVQRIGVIAQEISKIRP 116
            SD R+K N+  +             LY+Y Y  D             GV+AQE+ ++ P
Sbjct: 42  PSDIRVKENIIEIDTREQLRNVSRMKLYRYSYSQDYLEVAGLNTDPDTGVLAQEVKEVLP 101

Query: 117 DTVVE 121
           D V E
Sbjct: 102 DAVRE 106


>gi|227821710|ref|YP_002825680.1| hypothetical protein NGR_c11420 [Sinorhizobium fredii NGR234]
 gi|227340709|gb|ACP24927.1| hypothetical protein NGR_c11420 [Sinorhizobium fredii NGR234]
          Length = 506

 Score = 42.8 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 43/151 (28%), Gaps = 22/151 (14%)

Query: 16  QNVTVPKLPISLNNP---TPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
            + TVP +  + N P   +  A    +           +  +   +    +V        
Sbjct: 343 SSGTVPGMSYTNNGPLLLSRSAASVMSLQRSTSDGITATFHRSLSQVGSISVTTTATAYN 402

Query: 73  LVSDRRMKCNV-------KPVANLYQYRYLSDPK-NVQRIGVIAQEISKIRPDTV-VENN 123
             SD R K N          V  L    Y          +G IAQ++  I P+ V   + 
Sbjct: 403 TSSDGRAKINRLALMNSGDVVDALQPMTYDWVHAPGESGVGFIAQDLQAIVPEAVLAGDA 462

Query: 124 Q----------GIKSVDYGRLFNIGQIQTKQ 144
                         SVD  +L      + K 
Sbjct: 463 DPGKVPGDPGFEWWSVDMSKLVPYLVAELKD 493


>gi|170581054|ref|XP_001895519.1| hypothetical protein [Brugia malayi]
 gi|158597502|gb|EDP35634.1| conserved hypothetical protein [Brugia malayi]
          Length = 487

 Score = 42.8 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 11/76 (14%)

Query: 80  KCNVKPVANLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENNQGIKSV 129
           K  +  +A +    Y   P+          N  R+GVIAQE+++I PD V +N      V
Sbjct: 11  KIALSHLAQIRVVGYSYKPEIALKWGLSEENRHRVGVIAQELAEILPDAVTDNGD-YLQV 69

Query: 130 DYGRLFNIGQIQTKQK 145
           D  R+F        + 
Sbjct: 70  DDSRIFYETVAAATEL 85


>gi|256762671|ref|ZP_05503251.1| predicted protein [Enterococcus faecalis T3]
 gi|256683922|gb|EEU23617.1| predicted protein [Enterococcus faecalis T3]
          Length = 702

 Score = 42.8 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 45/157 (28%), Gaps = 24/157 (15%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
               V +  L +  +       I  + +       + +        FY  +NM       
Sbjct: 529 FDAGVQISNLNMGGSYVGGSGEIKNSTLVNTSVSTKFTVNNNVNLGFYSNLNMNGFSILN 588

Query: 74  VSDRRMKCNVKP--------VANLYQYRYLSD-----------PKNVQRIGVIAQEISKI 114
            SD R+K N+             L    +              P N + +G+IAQ     
Sbjct: 589 QSDVRLKENITDTKIDGIKETKKLNFVEFDRKQNYKSNNPIEQPSNKRELGLIAQ----Y 644

Query: 115 RPDT-VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P   V  N     S+D  +   +  +  KQ     +
Sbjct: 645 SPFLSVKHNEDHYLSLDMNKQVMLNSLTNKQLIEKIE 681


>gi|255972622|ref|ZP_05423208.1| predicted protein [Enterococcus faecalis T1]
 gi|255963640|gb|EET96116.1| predicted protein [Enterococcus faecalis T1]
          Length = 702

 Score = 42.8 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 45/157 (28%), Gaps = 24/157 (15%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
               V +  L +  +       I  + +       + +        FY  +NM       
Sbjct: 529 FDAGVQISNLNMGGSYVGGSGEIKNSTLVNTSVSTKFTVNNNVNLGFYSNLNMNGFSILN 588

Query: 74  VSDRRMKCNVKP--------VANLYQYRYLSD-----------PKNVQRIGVIAQEISKI 114
            SD R+K N+             L    +              P N + +G+IAQ     
Sbjct: 589 QSDVRLKENITDTKIDGIKETKKLNFVEFDRKQNYKSNNPIEQPSNKRELGLIAQ----Y 644

Query: 115 RPDT-VVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P   V  N     S+D  +   +  +  KQ     +
Sbjct: 645 SPFLSVKHNEDHYLSLDMNKQVMLNSLTNKQLIEKIE 681


>gi|255070487|ref|XP_002507325.1| predicted protein [Micromonas sp. RCC299]
 gi|226522600|gb|ACO68583.1| predicted protein [Micromonas sp. RCC299]
          Length = 876

 Score = 42.8 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 38/118 (32%), Gaps = 13/118 (11%)

Query: 18  VTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
             +     +  +              +   N         +   +A  +  Q A   SD 
Sbjct: 580 ANIAGGNNATLDWAGTGSGASMFYNSSTTYNVDIGIFASSRIATNADFVSAQGAFTHSDS 639

Query: 78  RMKCNVKPVAN-------------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
           R+K ++K + +             +Y Y+ +      + IG IA E+ ++ P  V + 
Sbjct: 640 RIKRDIKELNDDDALVKLRQIQPKIYGYKDIGVRPEEEVIGFIADEVEQVCPQAVRKT 697


>gi|240145536|ref|ZP_04744137.1| prophage protein [Roseburia intestinalis L1-82]
 gi|257202353|gb|EEV00638.1| prophage protein [Roseburia intestinalis L1-82]
          Length = 835

 Score = 42.8 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 42/131 (32%), Gaps = 20/131 (15%)

Query: 38  YAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ--LAPLVSDRRMKCNVKPVANL--YQYR 93
             G     +     +   G   F   V  G    +   +SD   K + + + +L    YR
Sbjct: 703 NKGGTDTDHCMINLDGDTGVAGFRGGVIDGSDKRMKNTISDLDKKRSSEFIYSLSAKSYR 762

Query: 94  YLSDPKNVQRIGVIAQEISK-------IRPDTVV-ENNQGIKSVDYGRLFN-------IG 138
           Y  +       G IAQ++ +       I P      N +    ++Y  L         + 
Sbjct: 763 YNFEKDGFHH-GFIAQDVLESVEEGWNICPQIFSNGNGEKYYGLNYTELIADLVATVQLQ 821

Query: 139 QIQTKQKKNTA 149
             + K+ K T 
Sbjct: 822 HEEIKELKETV 832


>gi|119594371|gb|EAW73965.1| chromosome 11 open reading frame 9, isoform CRA_c [Homo sapiens]
          Length = 855

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 26/69 (37%), Gaps = 18/69 (26%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 584 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 643

Query: 116 PDTVVENNQ 124
           P+ V +   
Sbjct: 644 PEAVKDTGD 652


>gi|3169156|gb|AAC23395.1| BC269730_4 [Homo sapiens]
 gi|60818508|gb|AAX36467.1| flap structure-specific endonuclease 1 [synthetic construct]
 gi|60830177|gb|AAX36915.1| flap structure-specific endonuclease 1 [synthetic construct]
          Length = 482

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 26/69 (37%), Gaps = 18/69 (26%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 211 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 270

Query: 116 PDTVVENNQ 124
           P+ V +   
Sbjct: 271 PEAVKDTGD 279


>gi|296218458|ref|XP_002807400.1| PREDICTED: LOW QUALITY PROTEIN: myelin gene regulatory factor-like
           [Callithrix jacchus]
          Length = 1156

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 26/69 (37%), Gaps = 18/69 (26%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 622 PSDLRAKEHVQEVDTTEQLKRISRMRLVHYRYKPEFAASAGIEAAAPETGVIAQEVKEIL 681

Query: 116 PDTVVENNQ 124
           P+ V +   
Sbjct: 682 PEAVKDTGD 690


>gi|291569223|dbj|BAI91495.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 843

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 39/146 (26%), Gaps = 28/146 (19%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
                Y   +  +  + +  R          +N         SD + K  +         
Sbjct: 688 YNGQTYFIKSSTLSSSGVHTRFRVGGTNVSYINDNGDYVKGSSDIKFKTLLSKPTLGLSE 747

Query: 86  VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
           +  L    +  +          + ++ G+IAQE+  I P+ V                  
Sbjct: 748 INALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVVKNDHTDSPEVDDKKI 807

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 808 DYLTIMYDKLIPLVIAAIQELSEKID 833


>gi|9634043|ref|NP_052117.1| tail fiber protein [Yersinia phage phiYeO3-12]
 gi|6599034|emb|CAB63638.1| tail fiber protein [Yersinia phage phiYeO3-12]
          Length = 645

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 23/139 (16%), Positives = 42/139 (30%), Gaps = 24/139 (17%)

Query: 36  IDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLY----- 90
            + +  A+     QL   + G                  SDRR+K ++K V +       
Sbjct: 500 NNNSLFAKPPGGVQLFTARGGYYLEGRVDGTAVGFRWFQSDRRLKEDIKVVRSADDMLNI 559

Query: 91  -----QYRYLSD--------------PKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY 131
                   Y                      R G I Q++ ++ P+ V   + G++S D 
Sbjct: 560 IRSYIPVSYKYKDASYTDNRGRTNTIEGKRSRAGFITQDLIRLWPEAVDVMSDGMQSPDP 619

Query: 132 GRLFNIGQIQTKQKKNTAQ 150
            ++     +  K      Q
Sbjct: 620 NQIIGGLMLLVKNLDARIQ 638


>gi|237803739|ref|ZP_04591324.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|237806767|ref|ZP_04593471.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331025721|gb|EGI05777.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331027880|gb|EGI07935.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 459

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 14/135 (10%), Positives = 29/135 (21%), Gaps = 18/135 (13%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMG 67
            ++   ++      ++   + +         +        N             +     
Sbjct: 273 INQNSGILTVAGALEVTGRVASAGTWCRAGLSAGRGGTVYNYNWTGSNVDVWIDNTYVGT 332

Query: 68  YQLAPLVSDRRMKCNVKP---------VANLYQYRYLSD-------PKNVQRIGVIAQEI 111
             L    SD R K  +           +       Y                 G+IA E 
Sbjct: 333 MTLFG--SDYRFKKYITDAKVPSYRDRINAYRIVTYQRKVFGAVFRGDGTTYQGLIAHEA 390

Query: 112 SKIRPDTVVENNQGI 126
             + P  V     G+
Sbjct: 391 QAVNPLAVTGEKDGV 405


>gi|255033746|ref|YP_003090191.1| hypothetical protein gp15 [Burkholderia phage KS9]
 gi|254832784|gb|ACT83026.1| hypothetical protein gp15 [Burkholderia phage KS9]
          Length = 602

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 34/120 (28%), Gaps = 22/120 (18%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA--------- 87
             +  A  +     +        +              SD R+K +V+ +          
Sbjct: 447 GGSASATAVASFTFTGTVNAHMFYDGGNAAFIGSLSQGSDYRIKKSVENIDTAEAYEGVR 506

Query: 88  NLYQYRY-----LSDPKNVQRIGVIAQEISKIRPDTVVENNQGI--------KSVDYGRL 134
            L    Y     + +    +  GVIA E   +  + V      +        ++VDY  L
Sbjct: 507 RLRFVDYLKTTNVGEDAERRIAGVIAHEAQAVFSNVVSGEKDAVEDDGRMKLQTVDYNGL 566


>gi|2724128|gb|AAB92668.1| Best's macular dystrophy related protein [Homo sapiens]
          Length = 185

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 26/69 (37%), Gaps = 18/69 (26%)

Query: 74  VSDRRMKCNVK---------PVANLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SD R K +V+          ++ +    Y   P+              GVIAQE+ +I 
Sbjct: 111 PSDLRAKEHVQEVDTTEQLKKISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEIL 170

Query: 116 PDTVVENNQ 124
           P+ V +   
Sbjct: 171 PEAVKDTGD 179


>gi|156540485|ref|XP_001601081.1| PREDICTED: similar to CG3328-PA [Nasonia vitripennis]
          Length = 728

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 32/101 (31%), Gaps = 29/101 (28%)

Query: 74  VSDRRMKCNVKP---------VANLYQYRYLSDP----------KNVQRIGVIAQEISKI 114
            SD R K NV           V  L   RY   P             +  GVIAQE+ +I
Sbjct: 89  PSDARAKQNVHELDTREQLKNVQQLRVVRYRYAPEFSQHLGLGIGTHEDTGVIAQEVKQI 148

Query: 115 RPDTV----------VENNQGIKSVDYGRLFNIGQIQTKQK 145
            P+ V           +       V+  R+F       K+ 
Sbjct: 149 LPEAVLPAGDIVLPNGQRIDNFLVVNKERIFMENIGAVKEL 189


>gi|322510920|gb|ADX06233.1| BNR-containing protein [Organic Lake phycodnavirus 2]
          Length = 862

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 52/146 (35%), Gaps = 6/146 (4%)

Query: 10  EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ 69
           +I +      +        +   +A +  AG   +      S      K+ +    +  +
Sbjct: 706 DISNQGTGPALKVSQFGNGDNNSVA-LFNAGSEGDALLIDSSGEVTIYKDMFVEGTIRTE 764

Query: 70  LAPLVSDRRMKCNVKPVANLYQYR----YLSDPKNVQRIGVIAQEISKIRP-DTVVENNQ 124
              + SDRR+K N++ ++ +   R          N + IG IA +I  I     VV  + 
Sbjct: 765 NIVMSSDRRLKTNIEDISGIDNIRKLQPKQYIKYNKKEIGFIANDILDIEDISFVVSKSS 824

Query: 125 GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              +++Y  LF +     K      +
Sbjct: 825 EYYALNYNSLFTLAIQSIKDLDEELK 850


>gi|206577956|ref|YP_002239181.1| hypothetical protein KPK_3357 [Klebsiella pneumoniae 342]
 gi|206567014|gb|ACI08790.1| hypothetical protein KPK_3357 [Klebsiella pneumoniae 342]
          Length = 133

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 34/126 (26%), Gaps = 19/126 (15%)

Query: 36  IDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV--------KPVA 87
             +A +  + Y    +                  +    SD R+K +         + + 
Sbjct: 2   TGHAAVYLDGYGRTDAWIFRAGGTISTGK---GDVLTTGSDVRLKEDFTESQEGASRRIN 58

Query: 88  NLYQYRYLSDPKNVQRIGVIAQEISKI--------RPDTVVENNQGIKSVDYGRLFNIGQ 139
            L    +    +  +R G IAQ+  K             +      + +VDY  +     
Sbjct: 59  ALGVCEFNMKGETRRRRGFIAQQAEKADDLYTFLGIEQEIDGEKFRVMNVDYTAIIADLV 118

Query: 140 IQTKQK 145
              +  
Sbjct: 119 TVVQDL 124


>gi|319899317|ref|YP_004159414.1| hypothetical protein BARCL_1172 [Bartonella clarridgeiae 73]
 gi|319403285|emb|CBI76844.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 374

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 48/138 (34%), Gaps = 19/138 (13%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           ++Q  QA++++  L++  T             I          +  Q  L   K      
Sbjct: 218 LEQDNQAWNQLERLLKLGTKAAGNYGTKTGESITMPSITKDPLHDAQRVLGLLKGIIG-- 275

Query: 61  YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQY---RYLSDPKNVQRIGVIAQEISKIRPD 117
                        +SD ++K N+  V     Y    +     + +  GV+AQ++  + PD
Sbjct: 276 -------------LSDVKVKENIVLVGKKNGYPLYEFNYKGNSQRYRGVLAQDLIHLNPD 322

Query: 118 TVVEN-NQGIKSVDYGRL 134
            V  N    +  V+Y  +
Sbjct: 323 AVYMNIKTHLLHVNYNTI 340


>gi|330792294|ref|XP_003284224.1| hypothetical protein DICPUDRAFT_147986 [Dictyostelium purpureum]
 gi|325085797|gb|EGC39197.1| hypothetical protein DICPUDRAFT_147986 [Dictyostelium purpureum]
          Length = 1035

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 43/139 (30%), Gaps = 18/139 (12%)

Query: 4   KQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDA 63
                ++ L+  Q        IS N+       +  G   +     ++     +    + 
Sbjct: 715 NNSFINDPLAHPQLPQPQPQHISNNSLGNKWATNTDGSLFHFGNVGVNSENPQEALSVNG 774

Query: 64  VNMGYQLAPLVSDRRMKCNVKP---------VANLYQYRYLSDPK--------NVQRIGV 106
                 +    SD+R+K NV P         +  L  Y Y    +          +  GV
Sbjct: 775 NVTISGIMYQPSDKRVKTNVVPVSSKKQLDNIMKLRIYDYKLTDEWVGTTNLTENKDRGV 834

Query: 107 IAQEI-SKIRPDTVVENNQ 124
           +AQE+     P+ V E   
Sbjct: 835 LAQELKQSNIPNAVKETGD 853


>gi|220906043|ref|YP_002481354.1| hypothetical protein Cyan7425_0603 [Cyanothece sp. PCC 7425]
 gi|219862654|gb|ACL42993.1| hypothetical protein Cyan7425_0603 [Cyanothece sp. PCC 7425]
          Length = 427

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 24/140 (17%), Positives = 44/140 (31%), Gaps = 19/140 (13%)

Query: 10  EILSLMQNVTVPKLPISLNNPTPIA----PIDYAGIAQNIYQNQLSERKEGKKEFYDAVN 65
           +I + ++   V    +S ++           +  G+  N      +    G         
Sbjct: 168 DISTAVRGDNVAGTGVSGSSTNGYGVYGDSTNGFGVYGNSPNGYSAIFSLGLNGLGTCSY 227

Query: 66  MGYQLAPLVSDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRIGVIAQEISKI 114
            G       SDR +K N + V++           L Q+      +    +G  AQ+  K 
Sbjct: 228 SGGADWFCSSDRTLKENFRSVSSVQILKQLAAMPLQQWTMKGAKQKEYHLGPTAQDFEKA 287

Query: 115 RPDTVV----ENNQGIKSVD 130
               V       ++GIK V 
Sbjct: 288 FGFGVKDMKVPEDKGIKGVK 307


>gi|281206155|gb|EFA80344.1| NDT80/PhoG-like protein [Polysphondylium pallidum PN500]
          Length = 1304

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 34/103 (33%), Gaps = 23/103 (22%)

Query: 41   IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK--------PVANLYQY 92
            I     +  ++     +    +   +        SDRR+K N+K         +  L  Y
Sbjct: 979  IIFTNSKVGINTPNPTQALSVNGNILVTGELFKPSDRRIKTNIKRDMSNHWAKIDKLKLY 1038

Query: 93   RYL---------------SDPKNVQRIGVIAQEISKIRPDTVV 120
             Y                S    V+  G +AQE+ ++ P+ V 
Sbjct: 1039 DYDRKKMVGYDAPFGGEDSKENTVRETGFLAQELKEVLPNAVT 1081


>gi|326435688|gb|EGD81258.1| hypothetical protein PTSG_11293 [Salpingoeca sp. ATCC 50818]
          Length = 874

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 30/120 (25%), Gaps = 20/120 (16%)

Query: 27  LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV--- 83
            N          +          +    E      +    G       SDRR+K N+   
Sbjct: 678 PNTHWSRGQTLNSVYHNGAVGINIDSPDEALCVRGNLRLSGA--IYQPSDRRIKRNISVR 735

Query: 84  ------KPVANLYQYRYL---------SDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
                   +  +  Y Y                  +G +AQE+  + P  V E      S
Sbjct: 736 DARASLDAIRRVRMYDYKLHEQYAKDNDRDAEEVHVGPLAQELRTVLPTAVKETTTMTLS 795


>gi|255531999|ref|YP_003092371.1| hypothetical protein Phep_2104 [Pedobacter heparinus DSM 2366]
 gi|255344983|gb|ACU04309.1| hypothetical protein Phep_2104 [Pedobacter heparinus DSM 2366]
          Length = 144

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 11/88 (12%), Positives = 27/88 (30%), Gaps = 20/88 (22%)

Query: 83  VKPVANLYQYRYLSDPKN--------VQRIGVIAQEISKIRPDTVVENNQGIKS------ 128
            + + NL    +  D            ++ G +A  +    P  V E ++  ++      
Sbjct: 43  TQHLKNLEPVTFQYDVNKYKHLKLPAGEQYGFMASNVQPEFPAMVYEASKVYEAGKNNAK 102

Query: 129 ------VDYGRLFNIGQIQTKQKKNTAQ 150
                 V    L  +     K+++   +
Sbjct: 103 VARYNEVQTENLIPVLVAAIKEQQAEIE 130


>gi|225011584|ref|ZP_03702022.1| hypothetical protein Flav2ADRAFT_1367 [Flavobacteria bacterium
           MS024-2A]
 gi|225004087|gb|EEG42059.1| hypothetical protein Flav2ADRAFT_1367 [Flavobacteria bacterium
           MS024-2A]
          Length = 250

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 9/72 (12%), Positives = 25/72 (34%), Gaps = 7/72 (9%)

Query: 81  CNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG--IKSVDYGRLFNIG 138
            ++  +  L Q ++     ++       +      P+ V  ++     KS+DY  L  + 
Sbjct: 175 TDILNIGLLLQGKWKKYFSSLTSNPFTPE-----FPELVTTHHNEKKYKSIDYIGLIPVL 229

Query: 139 QIQTKQKKNTAQ 150
                +++    
Sbjct: 230 MNALIEQQKEID 241


>gi|330974421|gb|EGH74487.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 459

 Score = 40.8 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 12/98 (12%), Positives = 21/98 (21%), Gaps = 16/98 (16%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQYRYL 95
                         + +        +    SD R K  +           +       Y 
Sbjct: 294 GGTVYNYNWTGSNVDVWIDNTYVGTMTLFGSDYRFKKYIANAKVPSYLDRIDAYRIVTYQ 353

Query: 96  SD-------PKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                           G+IA E  ++ P  V     G+
Sbjct: 354 RKIFGAVFSGDGTTYQGLIAHEAQEVNPLAVSGVKDGV 391


>gi|291570352|dbj|BAI92624.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 699

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 39/146 (26%), Gaps = 28/146 (19%)

Query: 33  IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP------- 85
                Y   +  +  + +  R          +N         SD + K  +         
Sbjct: 544 YNGQTYFIKSSTLSSSGVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTLGLSE 603

Query: 86  VANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------ 125
           +  L    +  +          + ++ G+IAQE+  I P+ V                  
Sbjct: 604 INALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVIKNDHTDSPEVDDKKI 663

Query: 126 -IKSVDYGRLFNIGQIQTKQKKNTAQ 150
              ++ Y +L  +     ++      
Sbjct: 664 DYLTIMYDKLIPLVIAAIQELSEKID 689


>gi|254521513|ref|ZP_05133568.1| gp32, bacteriophage protein [Stenotrophomonas sp. SKA14]
 gi|219719104|gb|EED37629.1| gp32, bacteriophage protein [Stenotrophomonas sp. SKA14]
          Length = 693

 Score = 40.4 bits (93), Expect = 0.072,   Method: Composition-based stats.
 Identities = 16/153 (10%), Positives = 38/153 (24%), Gaps = 16/153 (10%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
           + Q      L            I           N               V         
Sbjct: 535 ISQGNYGGGLGFIDTGGNTHGAIWTEYQTLQFGVNTPGALTPKMSLTSGGVLSTIGGYDF 594

Query: 74  VSDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
            S R++K     +                Y+   +    +R+  +A++++++ P+ V   
Sbjct: 595 GSSRKLKNIEGTLPYGLAAVEQMELAAGHYKPEYNDDGRRRLFFVAEQLAELVPEAVDLE 654

Query: 123 NQGIK-----SVDYGRLFNIGQIQTKQKKNTAQ 150
               +     SV   +L  +     ++     +
Sbjct: 655 GVEFQGERVASVKLDQLLPVLAKAIQELSAEVR 687


>gi|325508527|gb|ADZ20163.1| hypothetical protein CEA_G1125 [Clostridium acetobutylicum EA 2018]
          Length = 1085

 Score = 40.4 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 48/145 (33%), Gaps = 16/145 (11%)

Query: 16   QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVS 75
               +     I        +   Y   ++N+    ++E   G     +     +      S
Sbjct: 917  GGKSWNYHLIRNTIDNGTSQDYYILSSRNVMDFIMNEDSNGLGVHCNNGTTYWAYNFNAS 976

Query: 76   DRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKI---RPDTVVEN 122
            D R+K N+KP+           NL ++ ++        +G IAQ++SKI       +   
Sbjct: 977  DERLKTNIKPITTNCSSIINQINLKEFDFI-KTGEHIEVGTIAQQLSKINKKFSKILYTT 1035

Query: 123  NQG--IKSVDYGRLFNIGQIQTKQK 145
              G    + DY  +        ++ 
Sbjct: 1036 EDGTNFFAPDYNSILPYIIGAIQEL 1060


>gi|325104884|ref|YP_004274538.1| hypothetical protein Pedsa_2164 [Pedobacter saltans DSM 12145]
 gi|324973732|gb|ADY52716.1| hypothetical protein Pedsa_2164 [Pedobacter saltans DSM 12145]
          Length = 143

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 26/84 (30%), Gaps = 20/84 (23%)

Query: 83  VKPVANLYQYRYLSDPKN--------VQRIGVIAQEISKIRPDTVVENNQ---------- 124
              + +L    +  +             + G + + + ++ P  V E++           
Sbjct: 42  TSKLKSLQAVTFKYNVDKYKYLKLPQGNQYGFLVENVEQVFPAMVYESSSVYNINKGNTK 101

Query: 125 --GIKSVDYGRLFNIGQIQTKQKK 146
               K V+   L  +     K+++
Sbjct: 102 VAKYKEVNKDDLIPVLVEALKEQQ 125


>gi|241647486|ref|XP_002411143.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215503773|gb|EEC13267.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 416

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 8/53 (15%)

Query: 80  KCNVKPVANLYQYRYLSDPK--------NVQRIGVIAQEISKIRPDTVVENNQ 124
           K  +K VAN+   RY   P+             GV+AQE+ +I PD V E   
Sbjct: 216 KEQLKNVANMRIVRYRYIPEFVDQAGLSEAVDTGVLAQEVQQILPDAVREGGD 268


>gi|330958078|gb|EGH58338.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 423

 Score = 40.4 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 16/142 (11%), Positives = 30/142 (21%), Gaps = 19/142 (13%)

Query: 4   KQQAFHEILSLMQNVTVPKL-PISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
           K QA       +     P    + +                      +            
Sbjct: 235 KDQASARTALGLGTSQAPVFSGLDIVGRVSSFGTWCRTGFNGGKGGTVYNFNWTGNNVDV 294

Query: 63  AVNMG--YQLAPLVSDRRMKCNV---------KPVANLYQYRYLSD-------PKNVQRI 104
            ++      +    SD R+K  +           +       Y                 
Sbjct: 295 YIDSTYVGTMTLFTSDYRIKKFIKELKVPSYLDRIDAYRLVTYERKVFGDVFRGDGRVYQ 354

Query: 105 GVIAQEISKIRPDTVVENNQGI 126
           G+IA E  ++ P  V     G+
Sbjct: 355 GLIAHEAQEVNPLAVTGEKDGV 376


>gi|328874731|gb|EGG23096.1| NDT80/PhoG-like protein [Dictyostelium fasciculatum]
          Length = 1272

 Score = 40.4 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 17/103 (16%), Positives = 32/103 (31%), Gaps = 23/103 (22%)

Query: 41  IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV--------KPVANLYQY 92
           I     +  ++     +    +   +        SDRR+K N+          +  L  Y
Sbjct: 783 IVYTNGKVGINTNSPTQALTVNGNILVTGDLYKPSDRRIKSNIVRDSSNHWDKIDRLKIY 842

Query: 93  RYLSDP---------------KNVQRIGVIAQEISKIRPDTVV 120
            Y                     V+  G +AQE+ ++ P+ V 
Sbjct: 843 NYDRKKMPGYDNLAASATSSATMVKEKGFLAQELREVIPNAVS 885


>gi|291335290|gb|ADD94908.1| possible T4-like proximal tail fiber [uncultured phage
           MedDCM-OCT-S01-C104]
          Length = 861

 Score = 40.1 bits (92), Expect = 0.094,   Method: Composition-based stats.
 Identities = 22/180 (12%), Positives = 39/180 (21%), Gaps = 41/180 (22%)

Query: 7   AFHEILSLMQNVTVPK---LPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDA 63
             +   +   N  +       ++  N       D         +           +    
Sbjct: 672 TLNSCTTGGSNSAIGNTAGGSVTTGNGNTFLGNDAGRSNSPSGEITTGSNTICLGDNGIT 731

Query: 64  VNMGYQLAPLVSDRRMKCNVKP-------VANLYQYRYLS-------------------D 97
                  +   SD R K +V         +  L    Y                      
Sbjct: 732 GLFCADTSISSSDSRDKTDVTNFNIGLAWIEALRPVTYRWDRRTWYGTDAEPFGTPDGSK 791

Query: 98  PKNVQRIGVIAQEISKIR-----------PDTVVENNQGI-KSVDYGRLFNIGQIQTKQK 145
            +    IG +AQE   +               V   + G+   + Y RL  I     K+ 
Sbjct: 792 KRQRLHIGFLAQEALAVEQANGYGSSNDDSLLVNLTDDGMSYGMKYERLVPILVNAIKEL 851


>gi|330954038|gb|EGH54298.1| tail fiber domain-containing protein [Pseudomonas syringae Cit 7]
          Length = 380

 Score = 40.1 bits (92), Expect = 0.094,   Method: Composition-based stats.
 Identities = 12/98 (12%), Positives = 20/98 (20%), Gaps = 16/98 (16%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP---------VANLYQYRYL 95
                         + +        +    SD R K  +           +       Y 
Sbjct: 229 GGTVYNYNWTGSNVDVWIDNTYVGTMTLFGSDYRFKKYITDAKVPSYRDRINAYRIVTYQ 288

Query: 96  SD-------PKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                           G+IA E   + P  V     G+
Sbjct: 289 RKVFGAVFRGDGTTYQGLIAHEAQAVNPLAVTGEKDGV 326


>gi|301121068|ref|XP_002908261.1| hypothetical protein PITG_01633 [Phytophthora infestans T30-4]
 gi|262103292|gb|EEY61344.1| hypothetical protein PITG_01633 [Phytophthora infestans T30-4]
          Length = 149

 Score = 40.1 bits (92), Expect = 0.095,   Method: Composition-based stats.
 Identities = 22/148 (14%), Positives = 47/148 (31%), Gaps = 30/148 (20%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY----QLAP 72
               P  P+S++          + +         +  + G      A   G         
Sbjct: 12  GTGTPSAPLSVSGTVSNTFNAGSQLYAIGSSTAYTTSQLGPVTVSVAATFGGPIQCSSIY 71

Query: 73  LVSDRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
             SDRR K N++ +           ++Y Y+Y    + + +IG I  +++          
Sbjct: 72  CTSDRRCKENIELLDTTYCDKFYDLDVYTYKYRGSDETIPKIGFIRAQMN---------- 121

Query: 123 NQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                 +DY ++  I  +  K+     +
Sbjct: 122 ------IDYSKITAINFMMIKKLLKRIE 143


>gi|301381668|ref|ZP_07230086.1| tail fiber domain protein [Pseudomonas syringae pv. tomato Max13]
          Length = 425

 Score = 40.1 bits (92), Expect = 0.098,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 37/156 (23%), Gaps = 37/156 (23%)

Query: 8   FHEILSLMQNVTVPKLPISL--------NNPTPIAPIDYAGIAQNIYQN-QLSERKEGKK 58
               ++L Q  T  K   S               A +D AG   +     +         
Sbjct: 223 LTTPIALAQGGTGGKDQASARVALGLGAGQAPVFAGLDIAGRISSYGNWCRTGFSGSKGG 282

Query: 59  EFYDAVNMG------------YQLAPLVSDRRMKCNV---------KPVANLYQYRYLSD 97
             Y+    G              +    SD R+K  +           +       Y   
Sbjct: 283 TVYNFNWTGNNVDVYIDNTYVGTMTLFTSDYRIKKFIKELKVPSFLDRIDAYRLVTYERK 342

Query: 98  -------PKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                         G+IA E  ++ P  V     G+
Sbjct: 343 IFGDVFRGDGRVYQGLIAHEAQEVNPLAVTGEKDGV 378


>gi|332881303|ref|ZP_08448953.1| conserved domain protein [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332680679|gb|EGJ53626.1| conserved domain protein [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 417

 Score = 40.1 bits (92), Expect = 0.099,   Method: Composition-based stats.
 Identities = 8/47 (17%), Positives = 21/47 (44%)

Query: 100 NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
                G+ A+ + ++ PD V E+ +G   ++Y  +  +      + +
Sbjct: 255 EKTHYGLDAEVLKEVYPDLVYESQEGDLCINYTEMIPLLVQSVNELR 301


>gi|298487027|ref|ZP_07005079.1| Tail fiber domain protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298158469|gb|EFH99537.1| Tail fiber domain protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 445

 Score = 40.1 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 12/98 (12%), Positives = 20/98 (20%), Gaps = 16/98 (16%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP---------VANLYQYRYL 95
                         + +        +    SD R K  +           +       Y 
Sbjct: 294 GGTVYNYNWTGSNVDVWIDNTYVGTMTLFGSDYRFKKYIADAKVPSYRDRINAYRIVTYQ 353

Query: 96  SD-------PKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                           G+IA E   + P  V     G+
Sbjct: 354 RKVFGAVFRGDGTTYQGLIAHEAQAVNPLAVTGEKDGV 391


>gi|213970547|ref|ZP_03398674.1| tail fiber domain protein [Pseudomonas syringae pv. tomato T1]
 gi|213924718|gb|EEB58286.1| tail fiber domain protein [Pseudomonas syringae pv. tomato T1]
          Length = 425

 Score = 40.1 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 37/156 (23%), Gaps = 37/156 (23%)

Query: 8   FHEILSLMQNVTVPKLPISL--------NNPTPIAPIDYAGIAQNIYQN-QLSERKEGKK 58
               ++L Q  T  K   S               A +D AG   +     +         
Sbjct: 223 LTTPIALAQGGTGGKDQASARVALGLGAGQAPVFAGLDIAGRISSYGNWCRTGFSGSKGG 282

Query: 59  EFYDAVNMG------------YQLAPLVSDRRMKCNV---------KPVANLYQYRYLSD 97
             Y+    G              +    SD R+K  +           +       Y   
Sbjct: 283 TVYNFNWTGNNVDVYIDNTYVGTMTLFTSDYRIKKFIKELKVPSFLDRIDAYRLVTYERK 342

Query: 98  -------PKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                         G+IA E  ++ P  V     G+
Sbjct: 343 IFGDVFRGDGRVYQGLIAHEAQEVNPLAVTGEKDGV 378


>gi|194218289|ref|XP_001916246.1| PREDICTED: similar to C11orf9 [Equus caballus]
          Length = 1068

 Score = 40.1 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 28/85 (32%), Gaps = 20/85 (23%)

Query: 81  CNVKPVANLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENNQ------ 124
             +K ++ +    Y   P+               GVIAQE+ +I P+ V +         
Sbjct: 549 EQLKRISRMRLVHYRYKPEFAASAGIEATAAPETGVIAQEVKEILPEAVKDTGDVVFANG 608

Query: 125 ----GIKSVDYGRLFNIGQIQTKQK 145
                   V+  R+F       K+ 
Sbjct: 609 KTIENFLVVNKERIFMENVGAVKEL 633


>gi|301121160|ref|XP_002908307.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262103338|gb|EEY61390.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 349

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 33/134 (24%), Gaps = 26/134 (19%)

Query: 21  PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
                ++          Y           L          + +     Q     SDRR+K
Sbjct: 219 GSNSYTVGVGGTSNCYQYNVQGNIRSNLGLGPVSITVSAIFSSSIFCSQSIYTSSDRRLK 278

Query: 81  CNVKPV-------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGR 133
            N+ P+         L    Y    ++               P  V +      ++DY +
Sbjct: 279 ENITPISITLEHYDQLEPVIYSWKEESK--------------PKLVYQ-----YTLDYSQ 319

Query: 134 LFNIGQIQTKQKKN 147
           L  +     K   N
Sbjct: 320 LGALNAAAIKLLIN 333


>gi|255038279|ref|YP_003088900.1| hypothetical protein Dfer_4534 [Dyadobacter fermentans DSM 18053]
 gi|254951035|gb|ACT95735.1| hypothetical protein Dfer_4534 [Dyadobacter fermentans DSM 18053]
          Length = 361

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 42/158 (26%), Gaps = 26/158 (16%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLA 71
             +  N       +  +     +  D        +                 +  G    
Sbjct: 175 TRVSTNSQTGSFILGDDGG-GTSQNDAKNQMMMRFSGGYKLFTSSLNVLGVQLGAGGNAW 233

Query: 72  PLVSDRRMKCNVKPVA-----------NLYQYRYLS-DPKNVQRIGVIAQEISKIRPD-- 117
            ++SD R K N  PV            NL  + Y   DPK  +  G IAQ+  K      
Sbjct: 234 SVISDVRKKENFAPVNGEDFLQKISQINLTSWNYKGQDPKIFRHYGPIAQDFFKAFGQDS 293

Query: 118 ------TVVENNQGIKSVDYGRLFNI--GQIQTKQKKN 147
                     N      V+   L  I     +T+Q + 
Sbjct: 294 YGTIGSDTTINQADFDGVN---LIAIQALVKRTEQLQQ 328


>gi|310820118|ref|YP_003952476.1| hypothetical protein STAUR_2857 [Stigmatella aurantiaca DW4/3-1]
 gi|309393190|gb|ADO70649.1| uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 488

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/148 (14%), Positives = 45/148 (30%), Gaps = 13/148 (8%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
                      +  + T I     A          L  R +        +  G  +    
Sbjct: 290 SSGGFTGSFIWADQSTTNIVTNSAANQFMVRAAGGLRLRTKSDLSTGCDLPAGSGVFSCT 349

Query: 75  SDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           SDR  K + + V             +  +RY ++   V+ +G +AQ+          + +
Sbjct: 350 SDRDTKEDFRRVNGEEVLAKVAGMTVESWRYKTEAAGVRHVGPVAQDFRAAFGLGTDDKS 409

Query: 124 QGIKSVDYGRLFNI--GQIQTKQKKNTA 149
            G+  +D   +  I   + +T++     
Sbjct: 410 IGMLDIDGVNMVAIQALERRTQELNAKT 437


>gi|115374887|ref|ZP_01462160.1| Hep_Hag family [Stigmatella aurantiaca DW4/3-1]
 gi|115368105|gb|EAU67067.1| Hep_Hag family [Stigmatella aurantiaca DW4/3-1]
          Length = 478

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/148 (14%), Positives = 45/148 (30%), Gaps = 13/148 (8%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
                      +  + T I     A          L  R +        +  G  +    
Sbjct: 280 SSGGFTGSFIWADQSTTNIVTNSAANQFMVRAAGGLRLRTKSDLSTGCDLPAGSGVFSCT 339

Query: 75  SDRRMKCNVKPV-----------ANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           SDR  K + + V             +  +RY ++   V+ +G +AQ+          + +
Sbjct: 340 SDRDTKEDFRRVNGEEVLAKVAGMTVESWRYKTEAAGVRHVGPVAQDFRAAFGLGTDDKS 399

Query: 124 QGIKSVDYGRLFNI--GQIQTKQKKNTA 149
            G+  +D   +  I   + +T++     
Sbjct: 400 IGMLDIDGVNMVAIQALERRTQELNAKT 427


>gi|260593525|ref|ZP_05858983.1| conserved hypothetical protein [Prevotella veroralis F0319]
 gi|260534513|gb|EEX17130.1| conserved hypothetical protein [Prevotella veroralis F0319]
          Length = 151

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 7/37 (18%), Positives = 14/37 (37%)

Query: 114 IRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
             PD V  + +G K ++Y  L  +     +      +
Sbjct: 5   FIPDAVKTDEEGHKMINYTVLIPLLVQSVQDLTLQIE 41


>gi|296102080|ref|YP_003612226.1| hypothetical protein ECL_01719 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295056539|gb|ADF61277.1| hypothetical protein ECL_01719 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 153

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 31/101 (30%), Gaps = 24/101 (23%)

Query: 67  GYQLAPLVSDRRMKCN--------VKPVANLYQYRYLSDP--------KNVQRIGVIAQE 110
              LA   SD R+K           + ++ L    Y  +         K   R G IAQ+
Sbjct: 42  TGTLALATSDERLKEVISNQVDGYFERLSALKVVEYHWNDISGASPMAKARVRRGFIAQQ 101

Query: 111 ISKI-----RPDTVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
           ++ +      P    E       +D   +     +   + K
Sbjct: 102 VNAVNESYALP---PETEDDFWGIDDRAIVADLLLAVLELK 139


>gi|330004342|ref|ZP_08304900.1| hypothetical protein HMPREF9538_02582 [Klebsiella sp. MS 92-3]
 gi|328536714|gb|EGF63036.1| hypothetical protein HMPREF9538_02582 [Klebsiella sp. MS 92-3]
          Length = 513

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 29/90 (32%), Gaps = 11/90 (12%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLY-----------QYR 93
            Y   +                G       SD+  K ++KP   L             + 
Sbjct: 358 GYGAAVQYWHHRSDGMIWNSQRGDVAWAATSDKNFKRDIKPTDGLQSLQNINAMDLVTFI 417

Query: 94  YLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           Y  D +   R GVIAQ+I KI P  V  + 
Sbjct: 418 YNDDERQRLRRGVIAQQIQKIDPCYVKVSK 447


>gi|167515518|ref|XP_001742100.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778724|gb|EDQ92338.1| predicted protein [Monosiga brevicollis MX1]
          Length = 272

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 26/140 (18%), Positives = 44/140 (31%), Gaps = 30/140 (21%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN----- 88
             ++ +          +    E      +    G  L    SD R+K +++ +       
Sbjct: 116 GQVNQSVYYDGHVGVMMDNPDEALCVRGNIRLSGAIL--QPSDARIKRDIQHMDTAKALQ 173

Query: 89  ------LYQYRYLS-------DPKNVQRIGVIAQEISKIRPDTVVENN-----QG----- 125
                 L+ YR          +  N  + GV+AQE+  + PD V          G     
Sbjct: 174 NIERIPLHSYRLNGQWAATCGEDANRTQYGVVAQELKAVLPDAVRAGPSVTLNDGQEVTN 233

Query: 126 IKSVDYGRLFNIGQIQTKQK 145
           +  VD  RLF       +Q 
Sbjct: 234 LLVVDKERLFTEALAAVQQL 253


>gi|21243386|ref|NP_642968.1| hypothetical protein XAC2657 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108934|gb|AAM37504.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 455

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/159 (13%), Positives = 47/159 (29%), Gaps = 18/159 (11%)

Query: 5   QQAFHEILSL--MQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD 62
            Q  + I S   + + +       ++    I      G  +          ++       
Sbjct: 279 SQPGNGINSFAHLSSGSFGGGFGLIDGAYNIGFWSENGYLRIGMATNNGALQQRMGLTPS 338

Query: 63  AVNMGYQLAPLVSDRRMK-----------CNVKPVANLYQYRYLSDPKNVQRIGVIAQEI 111
                       S R++K              +    L +Y+   +P    R+   A+++
Sbjct: 339 GALSAVGGFDFGSSRKLKNIIGALPYGLAEVEQVTTLLGRYKKQYNPDGRVRLFFDAEQL 398

Query: 112 SKIRPDTVVENN---QGIK--SVDYGRLFNIGQIQTKQK 145
            +I P+TV       +G    +V   +L  +     KQ 
Sbjct: 399 LEIMPETVDARGVSFEGELVPAVHIDQLLPVAFNAIKQL 437


>gi|281204045|gb|EFA78241.1| NDT80/PhoG-like protein [Polysphondylium pallidum PN500]
          Length = 1015

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 22/166 (13%), Positives = 47/166 (28%), Gaps = 30/166 (18%)

Query: 15  MQNVTVPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAP 72
             + +V   P S  +       +    G   +     ++     +    +       +  
Sbjct: 680 TTSNSVDMAPSSTTSTIDEVGWNQNPHGGLYHYGNVGVNNENPTESLSVNGNISVTGILF 739

Query: 73  LVSDRRMKCNVKP---------VANLYQYRYL----SDPKNVQ----RIGVIAQEISKI- 114
             SD+R+K +++P         +  L  Y Y                  GV+AQE+ +  
Sbjct: 740 TPSDQRVKTDIRPVNTAEQLEHINRLRLYDYRLIKQWTDATGVTEPGDRGVLAQELQRAG 799

Query: 115 RPDTVVENNQ----------GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
            P+ V +                 V+   +F      T++      
Sbjct: 800 IPNAVKQTGDRTLNDGTVISDFLMVNKDAIFMENVGATQELSKKVD 845


>gi|15894398|ref|NP_347747.1| hypothetical protein CA_C1113 [Clostridium acetobutylicum ATCC 824]
 gi|15024032|gb|AAK79087.1|AE007628_1 Hypothetical protein CA_C1113 [Clostridium acetobutylicum ATCC 824]
          Length = 491

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 48/145 (33%), Gaps = 16/145 (11%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVS 75
              +     I        +   Y   ++N+    ++E   G     +     +      S
Sbjct: 323 GGKSWNYHLIRNTIDNGTSQDYYILSSRNVMDFIMNEDSNGLGVHCNNGTTYWAYNFNAS 382

Query: 76  DRRMKCNVKPVA----------NLYQYRYLSDPKNVQRIGVIAQEISKI---RPDTVVEN 122
           D R+K N+KP+           NL ++ ++        +G IAQ++SKI       +   
Sbjct: 383 DERLKTNIKPITTNCSSIINQINLKEFDFI-KTGEHIEVGTIAQQLSKINKKFSKILYTT 441

Query: 123 NQG--IKSVDYGRLFNIGQIQTKQK 145
             G    + DY  +        ++ 
Sbjct: 442 EDGTNFFAPDYNSILPYIIGAIQEL 466


>gi|330998158|ref|ZP_08321984.1| hypothetical protein HMPREF9442_03092 [Paraprevotella xylaniphila
           YIT 11841]
 gi|329568850|gb|EGG50648.1| hypothetical protein HMPREF9442_03092 [Paraprevotella xylaniphila
           YIT 11841]
          Length = 310

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 9/47 (19%), Positives = 21/47 (44%)

Query: 100 NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
                G+ A+ + +I PD V E+ +G   ++Y  +  +      + +
Sbjct: 254 EKTHYGLDAEVLKEIYPDLVYESQEGDLCINYTEMIPLLVQSVSELR 300


>gi|291566075|dbj|BAI88347.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 699

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 16/145 (11%), Positives = 39/145 (26%), Gaps = 28/145 (19%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------V 86
               +   +     +++  R          +N         SD + K  +         +
Sbjct: 545 GQTYFTKSSTLSSSSEVHTRFRVGGTNVSYINDNGDYVKGSSDLKFKTLLSKPTIGLSEI 604

Query: 87  ANLYQYRYLSDP--------KNVQRIGVIAQEISKIRPDTVVENNQG------------- 125
             L    +  +          + ++ G+IAQE+  I P+ V                   
Sbjct: 605 NALTVTWFKYNELAAFHGFNPSTEQFGLIAQEVQNIYPNAVEVVKNDHTDSPEVDDKKID 664

Query: 126 IKSVDYGRLFNIGQIQTKQKKNTAQ 150
             ++ Y +L  +     ++      
Sbjct: 665 YLTIMYDKLIPLVIAAIQELSEKID 689


>gi|291228384|ref|XP_002734150.1| PREDICTED: myelin gene regulatory factor-like [Saccoglossus
           kowalevskii]
          Length = 900

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 28/70 (40%), Gaps = 19/70 (27%)

Query: 74  VSDRRMKCNVKPVA---------NLYQYRYLSDPK----------NVQRIGVIAQEISKI 114
            SD R+K N++ V           L    Y   P+          N +  GV+AQ++  +
Sbjct: 522 PSDERVKENIEDVDTKEQLRKVAKLRLVSYDYIPEYIAHSGMSEQNSKTTGVLAQDLRDV 581

Query: 115 RPDTVVENNQ 124
            PD V E+  
Sbjct: 582 MPDAVKESGD 591


>gi|322835187|ref|YP_004215213.1| hypothetical protein Rahaq_4503 [Rahnella sp. Y9602]
 gi|321170388|gb|ADW76086.1| hypothetical protein Rahaq_4503 [Rahnella sp. Y9602]
          Length = 429

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 37/119 (31%), Gaps = 11/119 (9%)

Query: 11  ILSLMQNVT-VPKLPISLNNPTPIAPIDYAGIAQNIYQN--QLSERKEGKKEFYDAVNMG 67
           + +       +  L  S  N      ID  G + NI+      +   +    + +     
Sbjct: 209 LAAGQTGANPINTLGASYLNANQYMTIDVCGTSTNIFTRLVTWNTSFKVFGFYDNGNGTC 268

Query: 68  YQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                  SD R K N++   +            Y       + IGVIAQ++ +     V
Sbjct: 269 DGTWVGGSDERFKGNIEDFTDGLVATLSCRHVTYN-KQDGSREIGVIAQDVERFASCAV 326


>gi|330974326|gb|EGH74392.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 425

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 13/98 (13%), Positives = 22/98 (22%), Gaps = 16/98 (16%)

Query: 45  IYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQYRYL 95
                         + Y        +    SD R+K  +           +       Y 
Sbjct: 281 GGTVYNFNWTGNNVDVYIDSTYVGTMTLFTSDYRIKKFIKELKVPSYLDRIDAYRLVTYE 340

Query: 96  SD-------PKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                           G+IA E  ++ P  V     G+
Sbjct: 341 RKVFGDVFRGDGRVYQGLIAHEAQEVNPLAVTGEKDGV 378


>gi|298486648|ref|ZP_07004706.1| Tail fiber domain protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298158863|gb|EFH99925.1| Tail fiber domain protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 425

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 38/156 (24%), Gaps = 37/156 (23%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPTPI--------APIDYAGIAQNIYQN-QLSERKEGKK 58
               ++L Q  T  K   +  N   +        A +D  G   +     +         
Sbjct: 223 LTTPITLAQGGTGGKDQATARNALGLGTGQAPVFAGLDIVGRVSSNGTWCRTGFTGSRGG 282

Query: 59  EFYDAVNMG------------YQLAPLVSDRRMKCNV---------KPVANLYQYRYLSD 97
             Y+    G              +    SD R+K  +           +       Y   
Sbjct: 283 TVYNFNWTGNNVDVYIDNTYVGTMTLFTSDYRIKKFIKELKVPSFLDRIDAYRLVTYERK 342

Query: 98  -------PKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                         G+IA E  ++ P  V     G+
Sbjct: 343 IFGDVFRGDGRVYQGLIAHEAQEVNPLAVTGEKDGV 378


>gi|60681768|ref|YP_211912.1| hypothetical protein BF2290 [Bacteroides fragilis NCTC 9343]
 gi|60493202|emb|CAH07984.1| hypothetical protein BF2290 [Bacteroides fragilis NCTC 9343]
          Length = 1667

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 38/128 (29%), Gaps = 16/128 (12%)

Query: 18   VTVPKLPISL-NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +     I + +N         +    +           G    +   +     +   SD
Sbjct: 1487 ASDNTFGIGVHSNDHMYWWWGTSTSTNSSSGKSYIMDYGGGNWSFTGNHYVSGYSTWGSD 1546

Query: 77   RRMK----------CNVKPVANLYQYRYLSDP---KNVQRIGVIAQEISKIRPDTVVENN 123
             R K            +     +Y YR+ S       +  +G  AQ   +I P+   E +
Sbjct: 1547 SRYKTYLGEVTLQLDQIADSPTIY-YRWNSKKRDRDGLLHVGGYAQYTEQILPELTHETS 1605

Query: 124  QGIKSVDY 131
               K++DY
Sbjct: 1606 D-FKTMDY 1612


>gi|322832542|ref|YP_004212569.1| hypothetical protein Rahaq_1824 [Rahnella sp. Y9602]
 gi|321167743|gb|ADW73442.1| hypothetical protein Rahaq_1824 [Rahnella sp. Y9602]
          Length = 426

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 37/119 (31%), Gaps = 11/119 (9%)

Query: 11  ILSLMQNVT-VPKLPISLNNPTPIAPIDYAGIAQNIYQN--QLSERKEGKKEFYDAVNMG 67
           + +       +  L  S  N      ID  G + NI+      +   +    + +     
Sbjct: 209 LAAGQTGANPINTLGASYLNANQYMTIDVCGTSANIFTRLVTWNTSFKVFGFYDNGNGTC 268

Query: 68  YQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTV 119
                  SD R K N++   +            Y       + IGVIAQ++ +     V
Sbjct: 269 DGTWVGGSDERFKGNIEDFTDGLVATLSCRHVTYN-KQDGSREIGVIAQDVERFASCAV 326


>gi|157953842|ref|YP_001498733.1| hypothetical protein AR158_C652L [Paramecium bursaria Chlorella virus
            AR158]
 gi|156068490|gb|ABU44197.1| hypothetical protein AR158_C652L [Paramecium bursaria Chlorella virus
            AR158]
          Length = 1264

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 15/98 (15%), Positives = 27/98 (27%), Gaps = 15/98 (15%)

Query: 41   IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKC-----------NVKPVANL 89
                      +       +       G       SD R+K            ++    +L
Sbjct: 1110 TTNGNLILSGTSGDLTLTDGDGFKTTGGTTWSTPSDERLKHGITMANLHHCVDIIRNLDL 1169

Query: 90   YQYRYLS----DPKNVQRIGVIAQEISKIRPDTVVENN 123
             +Y           +   +G IAQ++ K  P  V E +
Sbjct: 1170 KKYSLNDEVSTKNTDKNVVGWIAQDVEKYIPKAVTERD 1207


>gi|198429773|ref|XP_002120171.1| PREDICTED: similar to Uncharacterized protein C11orf9 homolog
           [Ciona intestinalis]
          Length = 1291

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 35/100 (35%), Gaps = 28/100 (28%)

Query: 74  VSDRRMKCNVKPVA---------NLYQYRYLSDPK---------NVQRIGVIAQEISKIR 115
            SDRR K  ++ V          N+   RY   P+         N +  GVIAQE + + 
Sbjct: 663 PSDRRAKEAIEEVDSRDQLRNVQNIRICRYRYSPEYAMYAGIDSNREETGVIAQEFAGVL 722

Query: 116 PDTVV----------ENNQGIKSVDYGRLFNIGQIQTKQK 145
           P+ V           E       VD  RL+       K+ 
Sbjct: 723 PEAVRDTGEVRLANGETINNFLVVDKDRLYMENVGAVKEL 762


>gi|76810632|ref|YP_333040.1| hypothetical protein BURPS1710b_1636 [Burkholderia pseudomallei
           1710b]
 gi|254260966|ref|ZP_04952020.1| gp16 [Burkholderia pseudomallei 1710a]
 gi|76580085|gb|ABA49560.1| gp17 [Burkholderia pseudomallei 1710b]
 gi|254219655|gb|EET09039.1| gp16 [Burkholderia pseudomallei 1710a]
          Length = 471

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 40/132 (30%), Gaps = 22/132 (16%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q     +        ++        N       +        +     +    G     
Sbjct: 283 TQANLHLNG----TSGLSYLGFSGLNNTVGVQLRVSNNTSVAELQCVNYNASTFGV---- 334

Query: 62  DAVNMGYQLAPLVSDRRMKCNVKPVAN----LYQ---YRY--LSDPKNVQRIGVIAQEIS 112
               +        SDR  K +++P+ N    L     + Y    +P+  ++IGVIA E +
Sbjct: 335 ----LTASNFNQASDRAFKQDIRPLDNVMARLRGKQAFSYLLKHNPETGRQIGVIANEWA 390

Query: 113 KIRPDTVVENNQ 124
              P+ + E  +
Sbjct: 391 D-FPELLGEGPE 401


>gi|195997707|ref|XP_002108722.1| hypothetical protein TRIADDRAFT_18287 [Trichoplax adhaerens]
 gi|190589498|gb|EDV29520.1| hypothetical protein TRIADDRAFT_18287 [Trichoplax adhaerens]
          Length = 341

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 35/122 (28%), Gaps = 18/122 (14%)

Query: 21  PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
                  +  +  A         ++    ++ +   +                 SD R+K
Sbjct: 161 NPGQFESDGDSLWAKGSSPDTVIHMGHVGINTQTPDEALVVHGNVKVTGHITHPSDERVK 220

Query: 81  CNVKPVA---NLYQYR------YLSDPK---------NVQRIGVIAQEISKIRPDTVVEN 122
             V  V     L          +    +         ++   GV+AQ++ ++ PD V++ 
Sbjct: 221 HEVHEVNSSEQLRNVENMKLVQFKYKEQFAVPAGLDPSLLHTGVLAQQVKEVIPDAVIKT 280

Query: 123 NQ 124
             
Sbjct: 281 ED 282


>gi|291566264|dbj|BAI88536.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 699

 Score = 38.5 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 10/63 (15%), Positives = 21/63 (33%), Gaps = 13/63 (20%)

Query: 101 VQRIGVIAQEISKIRPDTVVENNQG-------------IKSVDYGRLFNIGQIQTKQKKN 147
            ++ G+IAQE+  I P+ V                     ++ Y +L  +     ++   
Sbjct: 627 TEQFGLIAQEVQNIYPNAVEVVKNDHTDSPEVDDKKIDYLTIMYDKLIPLVIAAIQELSE 686

Query: 148 TAQ 150
              
Sbjct: 687 KID 689


>gi|242015031|ref|XP_002428182.1| hypothetical protein Phum_PHUM368740 [Pediculus humanus corporis]
 gi|212512725|gb|EEB15444.1| hypothetical protein Phum_PHUM368740 [Pediculus humanus corporis]
          Length = 926

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 31/97 (31%), Gaps = 25/97 (25%)

Query: 74  VSDRRMK---------CNVKPVANLYQYRYLS------DPKNVQRIGVIAQEISKIRPDT 118
            SD R K           +K +  +   +Y        +    +  GVIAQEI  I PD 
Sbjct: 346 PSDLRAKLQVEECNTREQLKNIEQIRVVKYRYATGFAEEVGIKEDTGVIAQEIQGILPDA 405

Query: 119 VVENNQ----------GIKSVDYGRLFNIGQIQTKQK 145
           V +                 V+  R+F       K+ 
Sbjct: 406 VQKGGDVILPNGEVIENFLVVNKERIFMENVGAVKEL 442


>gi|115756495|ref|XP_001202502.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus
           purpuratus]
 gi|115938325|ref|XP_793768.2| PREDICTED: hypothetical protein, partial [Strongylocentrotus
           purpuratus]
          Length = 726

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 40/138 (28%), Gaps = 29/138 (21%)

Query: 37  DYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKP---------VA 87
                  +  +  ++  +  +                 SD+R K + +          + 
Sbjct: 550 SNQDTIFHSGKVGINTERPDEALVVYGNLKVTGHVMQPSDKRAKKDFQELDPREQLSNIN 609

Query: 88  NLYQYRYLSDPK----------NVQRIGVIAQEISKIRPDTVVENN----------QGIK 127
            +   RY   P+          +    GVIAQE+  I PD V +            +   
Sbjct: 610 KMRVMRYKYIPQFAEQAGLPECDQVETGVIAQEVMDILPDAVKKTGTVNLPGGAKIEHFL 669

Query: 128 SVDYGRLFNIGQIQTKQK 145
            V+  R++       K+ 
Sbjct: 670 VVNKDRIYMENVGAVKEL 687


>gi|291335620|gb|ADD95228.1| hypothetical protein [uncultured phage MedDCM-OCT-S04-C714]
          Length = 484

 Score = 38.5 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 38/125 (30%), Gaps = 15/125 (12%)

Query: 11  ILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQL 70
           I +      +     +           ++  A N      S          +  +   Q+
Sbjct: 316 ITANTNVDNIYSYAAATGTSAVCFRGGHSATAGNPGVGTDSIYIFANGNIQNTNDSYGQI 375

Query: 71  APLVSDRRMKCNVKPVA---------NLYQYRYLSDPK--NVQRIGVIAQEISKIRPDTV 119
               SD ++K N+   +            +Y + ++       ++GVIAQE+    P  V
Sbjct: 376 ----SDIKLKENIVDASSQWDDFKAVRFRKYNFKAETGHETHTQLGVIAQELELTSPGLV 431

Query: 120 VENNQ 124
            E   
Sbjct: 432 YETID 436


>gi|195029113|ref|XP_001987419.1| GH19977 [Drosophila grimshawi]
 gi|193903419|gb|EDW02286.1| GH19977 [Drosophila grimshawi]
          Length = 1465

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 33/105 (31%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDPK--------------NVQRIGVIAQE 110
            SD R K  +         + +  +   RY  +P+               +   GVIAQE
Sbjct: 604 PSDSRAKQEIAELDTSVQLRNMQKIRIVRYRYEPEYAVHSGLRRESDTREIVDTGVIAQE 663

Query: 111 ISKIRPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
           + ++ PD V E        G        V+  R+        K+ 
Sbjct: 664 VREVIPDAVQEAGSVVLPNGNVIENFLLVNKDRILMENIGAVKEL 708


>gi|160915558|ref|ZP_02077769.1| hypothetical protein EUBDOL_01566 [Eubacterium dolichum DSM 3991]
 gi|158432678|gb|EDP10967.1| hypothetical protein EUBDOL_01566 [Eubacterium dolichum DSM 3991]
          Length = 827

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 30/114 (26%), Gaps = 12/114 (10%)

Query: 14  LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPL 73
           L     +                 Y    +  Y           +       +  +   +
Sbjct: 628 LAAGTILHPTGAEWIGFYSSNANAYTNTKRKTYIGPNGTTNFYIQNEAGGSCIVNKAWSV 687

Query: 74  VSDRRMKCNVKPV--------ANLYQYRYLSDP----KNVQRIGVIAQEISKIR 115
            SD+R+K ++K +          L    +  +      +    G+IAQ++    
Sbjct: 688 GSDKRLKKDIKDIADVYVDIWKELNPKTFKWNDINYGTDKNEFGLIAQDVIAAF 741


>gi|157953029|ref|YP_001497921.1| hypothetical protein NY2A_B725L [Paramecium bursaria Chlorella virus
            NY2A]
 gi|155123256|gb|ABT15124.1| hypothetical protein NY2A_B725L [Paramecium bursaria Chlorella virus
            NY2A]
          Length = 1191

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 39/138 (28%), Gaps = 18/138 (13%)

Query: 4    KQQAFHEILS---LMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
            +  +   + +   L+                    +   G   ++  +  S         
Sbjct: 997  RNASLTNVSNSVMLVNGSVAGASQPGQLLLDTNGNLTLTGTRGDLTLSGTSGDLTLTTAT 1056

Query: 61   YDAVNMGYQLAPLVSDRRMKCNVKPVA-----------NLYQYRYLSD----PKNVQRIG 105
              A      L    SD R+K ++               +L +Y    +      N   +G
Sbjct: 1057 AQAYKPTGTLWINTSDERLKHDITMANLHHCVDIIRHLDLKKYSLNDEVSTSETNKNVVG 1116

Query: 106  VIAQEISKIRPDTVVENN 123
             IAQ++ K  P  V E +
Sbjct: 1117 WIAQDVEKYIPKAVTERD 1134


>gi|37523052|ref|NP_926429.1| hypothetical protein gll3483 [Gloeobacter violaceus PCC 7421]
 gi|35214055|dbj|BAC91424.1| gll3483 [Gloeobacter violaceus PCC 7421]
          Length = 442

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 18/140 (12%), Positives = 33/140 (23%), Gaps = 18/140 (12%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVN--MGYQLAPLV 74
             T      +      ++     G       +                    G       
Sbjct: 253 GATGVVGESTEAEGAGLSGASSGGYGVVASSSSGHAAHFSGGADGGGTCYFAGGSGWSCT 312

Query: 75  SDRRMKCNVKPVA---NLY--------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           SDR  K N +P+     L          +    D +   RIG  AQ+        V  + 
Sbjct: 313 SDRAQKENFRPIDPKAVLRQLDGLTVAGWTMKGDSRQTPRIGPTAQDFHAAF--GVGGDE 370

Query: 124 QGIKSVDYGRLFNIGQIQTK 143
              K+++      +     +
Sbjct: 371 ---KTINTADAQGVALAAIQ 387


>gi|149278651|ref|ZP_01884787.1| DNA topoisomerase IV subunit A [Pedobacter sp. BAL39]
 gi|149230646|gb|EDM36029.1| DNA topoisomerase IV subunit A [Pedobacter sp. BAL39]
          Length = 146

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 32/102 (31%), Gaps = 27/102 (26%)

Query: 76  DRRMKCNVKPVAN-------LYQYRYLSDPKN--------VQRIGVIAQEISKIRPDTVV 120
           D+ +K NV  +AN       L    +  D K           + G + + +S   P  VV
Sbjct: 31  DQELKINVSKIANSTQHLINLEPVTFQYDVKKFKNLSLPSTSQYGFLTRSVSAEFPSLVV 90

Query: 121 ENNQG------------IKSVDYGRLFNIGQIQTKQKKNTAQ 150
           + +                 V    L  +     K+++   +
Sbjct: 91  QKSTQVNAGKNASKVASYDEVKTAELIPVLVAAIKEQQAEIE 132


>gi|195383392|ref|XP_002050410.1| GJ20217 [Drosophila virilis]
 gi|194145207|gb|EDW61603.1| GJ20217 [Drosophila virilis]
          Length = 1450

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 33/105 (31%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDPK--------------NVQRIGVIAQE 110
            SD R K  +         + +  +   RY  +P+               +   GVIAQE
Sbjct: 603 PSDSRAKQEIAELDTSVQLRNMQKIRIVRYRYEPEFAVHSGLRRESDTREIVDTGVIAQE 662

Query: 111 ISKIRPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
           + ++ PD V E        G        V+  R+        K+ 
Sbjct: 663 VREVIPDAVQEAGSVVLPNGNVIENFLLVNKDRILMENIGAVKEL 707


>gi|328866338|gb|EGG14723.1| NDT80/PhoG-like protein [Dictyostelium fasciculatum]
          Length = 857

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 42/130 (32%), Gaps = 22/130 (16%)

Query: 11  ILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQL 70
           I SL+    +  +       T     +         +  ++          +      + 
Sbjct: 602 ITSLLGAPNLNTMKFGSCEWTKG---ESDRSIIYHGKVGVNVDNPTFALSVNGTIYASEG 658

Query: 71  APLVSDRRMK---------CNVKPVANLYQYRYL----------SDPKNVQRIGVIAQEI 111
               SD R+K          N++ V ++  Y Y            DP   Q  G+IAQE+
Sbjct: 659 VYHPSDLRIKYDLHQVDTRTNLRNVNSMKIYDYKLHPEWVYMNGMDPYENQDRGIIAQEL 718

Query: 112 SKIRPDTVVE 121
            +I P++V  
Sbjct: 719 KEILPESVKT 728


>gi|194379044|dbj|BAG58073.1| unnamed protein product [Homo sapiens]
          Length = 537

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 24/76 (31%), Gaps = 19/76 (25%)

Query: 89  LYQYRYLSDPK---------NVQRIGVIAQEISKIRPDTVVENNQ----------GIKSV 129
           +    Y   P+              GVIAQE+ +I P+ V +                 V
Sbjct: 1   MRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEILPEAVKDTGDMVFANGKTIENFLVV 60

Query: 130 DYGRLFNIGQIQTKQK 145
           +  R+F       K+ 
Sbjct: 61  NKERIFMENVGAVKEL 76


>gi|38707906|ref|NP_945046.1| gp16 [Burkholderia phage phi1026b]
 gi|38505398|gb|AAR23167.1| gp16 [Burkholderia phage phi1026b]
          Length = 462

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 31/126 (24%), Gaps = 10/126 (7%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q     + +  L       +           +    A +    Y               
Sbjct: 276 TQANLHLNGLGGLSCLGFSGQNNTVGVQLRVSSNTAVAELQCINYNATSFGVLSASNFNQ 335

Query: 62  DAVNMGYQLAPLVSDRRMKCNVK-PVANLYQYRY--LSDPKNVQRIGVIAQEISKIRPDT 118
                        SD R    V   +       Y   ++P+  ++ GVIA E     P+ 
Sbjct: 336 ------ASDRAFKSDIRTLEKVMARLRGKRGVTYLQKNNPEAGRQAGVIANEWWD-FPEL 388

Query: 119 VVENNQ 124
           + E  +
Sbjct: 389 LGEGPE 394


>gi|66799923|ref|XP_628887.1| NDT80/PhoG-like protein [Dictyostelium discoideum AX4]
 gi|74850434|sp|Q54B29|Y3934_DICDI RecName: Full=Uncharacterized membrane protein DDB_G0293934
 gi|60462239|gb|EAL60466.1| NDT80/PhoG-like protein [Dictyostelium discoideum AX4]
          Length = 1713

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 33/104 (31%), Gaps = 24/104 (23%)

Query: 41   IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK--------PVANLYQY 92
            +     +  ++     +    +   +        SD+R+K N++         +  L  Y
Sbjct: 1206 VIYTNNKVGINTTTPTQALAVNGNILVTGELFKPSDQRIKSNIRLDNTDHWDKINRLKIY 1265

Query: 93   RYLSD----------------PKNVQRIGVIAQEISKIRPDTVV 120
             Y                      V+  G +AQE+ ++ P+ V 
Sbjct: 1266 DYDRKKMMGYDDPNNNGTTQESTTVKEKGFLAQEVKEVLPNAVK 1309


>gi|190573077|ref|YP_001970922.1| putative phage tail protein [Stenotrophomonas maltophilia K279a]
 gi|190010999|emb|CAQ44608.1| putative phage tail protein [Stenotrophomonas maltophilia K279a]
          Length = 655

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 13/153 (8%), Positives = 40/153 (26%), Gaps = 16/153 (10%)

Query: 9   HEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGY 68
           +  +  + +       I  +                      + + +  +          
Sbjct: 492 NTFVGGVTSAGGNAAFIIKDRGNANQEFHIYNTDNVFRIWSSTAQVDRLQLNAAGALWTA 551

Query: 69  QLAPLVSDRRMKCNV---------KPVANLYQYRYL--SDPKNVQRIGVIAQEISKIRPD 117
                 S R++K                 L    Y    +    +R+  +A++++++ P+
Sbjct: 552 GGFDTGSSRKLKNIEGALPYGLAAVEQMELAAGHYKPEYNDDGRRRLFFVAEQLAELVPE 611

Query: 118 TVVENNQGIK-----SVDYGRLFNIGQIQTKQK 145
            V       +     SV   +L  +     ++ 
Sbjct: 612 AVDLEGVEFQGERVASVKLDQLLPVMAKAIQEL 644


>gi|76810716|ref|YP_333093.1| hypothetical protein BURPS1710b_1690 [Burkholderia pseudomallei
           1710b]
 gi|254261037|ref|ZP_04952091.1| gp16 [Burkholderia pseudomallei 1710a]
 gi|76580169|gb|ABA49644.1| gp16 [Burkholderia pseudomallei 1710b]
 gi|254219726|gb|EET09110.1| gp16 [Burkholderia pseudomallei 1710a]
          Length = 462

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 31/126 (24%), Gaps = 10/126 (7%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q     + +  L       +           +    A +    Y               
Sbjct: 276 TQANLHLNGLGGLSCLGFSGQNNTVGVQLRVSSNTAVAELQCINYNATSFGVLSASNFNQ 335

Query: 62  DAVNMGYQLAPLVSDRRMKCNVK-PVANLYQYRY--LSDPKNVQRIGVIAQEISKIRPDT 118
                        SD R    V   +       Y   ++P+  ++ GVIA E     P+ 
Sbjct: 336 ------ASDRAFKSDIRTLEKVMARLRGKRGVTYLQKNNPEAGRQAGVIANEWWD-FPEL 388

Query: 119 VVENNQ 124
           + E  +
Sbjct: 389 LGEGPE 394


>gi|319936069|ref|ZP_08010491.1| hypothetical protein HMPREF9488_01322 [Coprobacillus sp. 29_1]
 gi|319808856|gb|EFW05374.1| hypothetical protein HMPREF9488_01322 [Coprobacillus sp. 29_1]
          Length = 373

 Score = 37.7 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 21/168 (12%), Positives = 46/168 (27%), Gaps = 41/168 (24%)

Query: 22  KLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKC 81
                         +   G   N+Y    +     +  F    +     A + SDR +K 
Sbjct: 192 NFISGRTTSGASVGMLVRGDDNNVYVGYYNNGTIIRGSFCKLGSASG--ATITSDRNLKK 249

Query: 82  NVKPVAN-------LYQYRYLSD--PKNVQRIGVIAQEISKIRPD--------------- 117
           N+ P+ +       L    ++ D        +G I+Q++ K   +               
Sbjct: 250 NITPLNDYELFFSKLKPVSFVYDITHHKRTHLGFISQDVEKALKESSLNNEKFSGLCIDK 309

Query: 118 -----TVVENNQ----------GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
                   E++            I S+ Y     +     ++++    
Sbjct: 310 ISNCQIYDEDSDERILLNKGIKEIYSLRYEEFIALNTHMIQKQQTEID 357


>gi|198458093|ref|XP_002138495.1| GA24806 [Drosophila pseudoobscura pseudoobscura]
 gi|198136219|gb|EDY69053.1| GA24806 [Drosophila pseudoobscura pseudoobscura]
          Length = 1471

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 33/105 (31%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDPK--------------NVQRIGVIAQE 110
            SD R K  +         + +  +   RY  +P+               +   GVIAQE
Sbjct: 635 PSDSRAKQEIGELDTSVQLRNLQKIRIVRYRYEPEFALHSGLRRQSDTREIVDTGVIAQE 694

Query: 111 ISKIRPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
           + ++ PD V E        G        V+  R+        K+ 
Sbjct: 695 VREVIPDAVQEAGSVVLPNGDVIENFLLVNKDRILMENIGAVKEL 739


>gi|330996416|ref|ZP_08320299.1| conserved domain protein [Paraprevotella xylaniphila YIT 11841]
 gi|329573274|gb|EGG54888.1| conserved domain protein [Paraprevotella xylaniphila YIT 11841]
          Length = 421

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 7/47 (14%), Positives = 20/47 (42%)

Query: 100 NVQRIGVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKK 146
                G+ A  + ++ PD + E+ +G   ++Y  +  +      + +
Sbjct: 259 EKTHYGLDAAVLKEVYPDLIYESQEGDLCINYTEMIPLLVQSVNELR 305


>gi|195121118|ref|XP_002005068.1| GI20264 [Drosophila mojavensis]
 gi|193910136|gb|EDW09003.1| GI20264 [Drosophila mojavensis]
          Length = 1452

 Score = 37.4 bits (85), Expect = 0.60,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 33/105 (31%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDPK--------------NVQRIGVIAQE 110
            SD R K  +         + +  +   RY  +P+               +   GVIAQE
Sbjct: 604 PSDSRAKQEIAELDTSVQLRNMQKIRIVRYRYEPEFAVHSGLRRESDTREIVDTGVIAQE 663

Query: 111 ISKIRPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
           + ++ PD V E        G        V+  R+        K+ 
Sbjct: 664 VREVIPDAVQEAGSVVLPNGNVIENFLLVNKDRILMENIGAVKEL 708


>gi|134288666|ref|YP_001111096.1| gp17 [Burkholderia phage phi644-2]
 gi|134132051|gb|ABO60848.1| gp17 [Burkholderia phage phi644-2]
          Length = 462

 Score = 37.4 bits (85), Expect = 0.60,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 30/126 (23%), Gaps = 10/126 (7%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q     + +  L       +                A +    Y               
Sbjct: 276 TQANLHLNGLGGLSCLGFSGQNNTVGVQLRVSNNTAVAELQCINYNATSFGVLSASNFNQ 335

Query: 62  DAVNMGYQLAPLVSDRRMKCNVK-PVANLYQYRY--LSDPKNVQRIGVIAQEISKIRPDT 118
                        SD R    V   +       Y   ++P+  ++ GVIA E     P+ 
Sbjct: 336 ------ASDRAFKSDIRTLEKVMARLRGKRGVTYLQKNNPEAGRQAGVIANEWWD-FPEL 388

Query: 119 VVENNQ 124
           + E  +
Sbjct: 389 LGEGPE 394


>gi|294624479|ref|ZP_06703163.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292601228|gb|EFF45281.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 487

 Score = 37.4 bits (85), Expect = 0.65,   Method: Composition-based stats.
 Identities = 23/172 (13%), Positives = 48/172 (27%), Gaps = 34/172 (19%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPT------------PIAPIDYAGIAQNIYQ--NQLSER 53
            +   SL+   TV      +N+               I      G           ++  
Sbjct: 298 LNTAGSLLLKATVSSPGNGVNSFAHLSSGSFGGGFGLIDGAYNIGFWSENGHLRIGMATY 357

Query: 54  KEGKKEFYDAVNMGY----QLAPLVSDRRMK-----------CNVKPVANLYQYRYLSDP 98
               ++       G           S R++K              +    L +Y+   +P
Sbjct: 358 NGALQQRMGLTTSGALSAVGGFDFGSSRKLKNIIGALPYGLAEVEQVTTLLGRYKEQYNP 417

Query: 99  KNVQRIGVIAQEISKIRPDTVVENNQGIKS-----VDYGRLFNIGQIQTKQK 145
               R+   A+++ ++ P+TV  +    +      V   +L  +     KQ 
Sbjct: 418 DGRVRLFFDAEQLLEVMPETVDAHGVSFQGELVPAVHIDQLLPVAFNAIKQL 469


>gi|195153789|ref|XP_002017806.1| GL17372 [Drosophila persimilis]
 gi|194113602|gb|EDW35645.1| GL17372 [Drosophila persimilis]
          Length = 1468

 Score = 37.4 bits (85), Expect = 0.66,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 33/105 (31%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDPK--------------NVQRIGVIAQE 110
            SD R K  +         + +  +   RY  +P+               +   GVIAQE
Sbjct: 629 PSDSRAKQEIGELDTSVQLRNLQKIRIVRYRYEPEFALHSGLRRQSDTREIVDTGVIAQE 688

Query: 111 ISKIRPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
           + ++ PD V E        G        V+  R+        K+ 
Sbjct: 689 VREVIPDAVQEAGSVVLPNGDVIENFLLVNKDRILMENIGAVKEL 733


>gi|319649429|ref|ZP_08003585.1| hypothetical protein HMPREF1013_00189 [Bacillus sp. 2_A_57_CT2]
 gi|317398591|gb|EFV79273.1| hypothetical protein HMPREF1013_00189 [Bacillus sp. 2_A_57_CT2]
          Length = 1179

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 21/138 (15%), Positives = 41/138 (29%), Gaps = 13/138 (9%)

Query: 1    MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
            ++         +  +   T           +    +  A  A   + +  S  +      
Sbjct: 1003 LNNNNLTIANEIGRVFISTSDGGNAEFMGLSGHDGLRMASGAVLKWLSSSSTIQVRNNSD 1062

Query: 61   YDAVNMGYQLAPLVSDRRMKCNVKPVAN----------LYQYRYLSDPKNVQRIGVIAQE 110
                 M   ++   SDRR+K N+ P             +Y Y  +    +   +G+IA E
Sbjct: 1063 STYGTMQAIISDA-SDRRLKRNINPYEESALEKVLATPIYTYNMIGHEDSKLFMGMIADE 1121

Query: 111  ISK--IRPDTVVENNQGI 126
              +  +      E   GI
Sbjct: 1122 APEDIVIKGDTPEMPDGI 1139


>gi|225573593|ref|ZP_03782348.1| hypothetical protein RUMHYD_01787 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039068|gb|EEG49314.1| hypothetical protein RUMHYD_01787 [Blautia hydrogenotrophica DSM
           10507]
          Length = 774

 Score = 37.4 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 14/113 (12%), Positives = 34/113 (30%), Gaps = 18/113 (15%)

Query: 56  GKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN--------LYQYRYLSDPK-------- 99
                    +         S +R K +VK + +        ++   +             
Sbjct: 646 SGGHIVFGSDGVTLAYLASSSKRYKNHVKDMTDRDAEKLLDIHVVWFKYKDGYLSQTDHM 705

Query: 100 -NVQRIGVIAQEISKIRPDTVVENNQGI-KSVDYGRLFNIGQIQTKQKKNTAQ 150
              +  G  A+E++ + PD V  +  G  +  +Y  +        K++    +
Sbjct: 706 CGKEIPGFYAEELNDVIPDVVQYDKDGKPEDWNYRAMIPYMVQLLKKQNEEIK 758


>gi|195489549|ref|XP_002092786.1| GE14386 [Drosophila yakuba]
 gi|194178887|gb|EDW92498.1| GE14386 [Drosophila yakuba]
          Length = 1426

 Score = 37.4 bits (85), Expect = 0.78,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 40/137 (29%), Gaps = 33/137 (24%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQY 92
             +  +  ++  +  +                 SD R K  +         + +  +   
Sbjct: 571 VFHTGRVGINTDRPDESLVVHGNLKVSGHIVQPSDSRAKQEIGELDTSVQLRNLQKIRIV 630

Query: 93  RYLSDPK--------------NVQRIGVIAQEISKIRPDTVVEN-----NQG-----IKS 128
           RY   P+               V+  GVIAQE+ ++ PD V E        G        
Sbjct: 631 RYRYMPEFAVHSGLRRESDTREVEDTGVIAQEVREVIPDAVQEAGSVVLPNGNVIEKFLL 690

Query: 129 VDYGRLFNIGQIQTKQK 145
           V+  R+        K+ 
Sbjct: 691 VNKDRILMENIGAVKEL 707


>gi|194756832|ref|XP_001960674.1| GF11379 [Drosophila ananassae]
 gi|190621972|gb|EDV37496.1| GF11379 [Drosophila ananassae]
          Length = 1438

 Score = 37.0 bits (84), Expect = 0.79,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 33/105 (31%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDPK--------------NVQRIGVIAQE 110
            SD R K  +         + +  +   RY  +P+               +   GVIAQE
Sbjct: 613 PSDSRAKQEIGELDTSVQLRNLQKIRIVRYRYEPEFAVHSGLRRESDTREIVDTGVIAQE 672

Query: 111 ISKIRPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
           + ++ PD V E        G        V+  R+        K+ 
Sbjct: 673 VREVIPDAVQEAGSVVLPNGNVIENFLLVNKDRILMENIGAVKEL 717


>gi|195455328|ref|XP_002074671.1| GK23038 [Drosophila willistoni]
 gi|194170756|gb|EDW85657.1| GK23038 [Drosophila willistoni]
          Length = 1507

 Score = 37.0 bits (84), Expect = 0.80,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 34/105 (32%), Gaps = 33/105 (31%)

Query: 74  VSDRRMKCNV---------KPVANLYQYRYLSDPK--------------NVQRIGVIAQE 110
            SD R K  +         + +  +   RY  +P+               +   GVIAQE
Sbjct: 640 PSDSRAKQEIGELDTSVQLRNLQKIRIVRYRYEPEFAVHSGLRRESDTREIVDTGVIAQE 699

Query: 111 ISKIRPDTVVEN-----NQG-----IKSVDYGRLFNIGQIQTKQK 145
           + ++ PD V E        G        V+  R+        K+ 
Sbjct: 700 VREVIPDAVQEAGSVVLPNGNVIENFLLVNKDRILMENIGAVKEL 744


>gi|325926105|ref|ZP_08187466.1| hypothetical protein XPE_1430 [Xanthomonas perforans 91-118]
 gi|325543450|gb|EGD14872.1| hypothetical protein XPE_1430 [Xanthomonas perforans 91-118]
          Length = 599

 Score = 37.0 bits (84), Expect = 0.81,   Method: Composition-based stats.
 Identities = 23/172 (13%), Positives = 48/172 (27%), Gaps = 34/172 (19%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPT------------PIAPIDYAGIAQNIYQ--NQLSER 53
            +   SL+   TV      +N+               I      G           ++  
Sbjct: 410 LNTAGSLLLKATVSSPGNGVNSFAHLSSGSFGGGFGLIDGAYNIGFWSENGHLRIGMATY 469

Query: 54  KEGKKEFYDAVNMGY----QLAPLVSDRRMK-----------CNVKPVANLYQYRYLSDP 98
               ++       G           S R++K              +    L +Y+   +P
Sbjct: 470 NGALQQRMGLTTSGALSAVGGFDFGSSRKLKNIIGALPYGLAEVEQVTTLLGRYKEQYNP 529

Query: 99  KNVQRIGVIAQEISKIRPDTVVENNQGIKS-----VDYGRLFNIGQIQTKQK 145
               R+   A+++ ++ P+TV  +    +      V   +L  +     KQ 
Sbjct: 530 DGRVRLFFDAEQLLEVMPETVDAHGVSFQGELVPAVHIDQLLPVAFNAIKQL 581


>gi|194886182|ref|XP_001976566.1| GG22949 [Drosophila erecta]
 gi|190659753|gb|EDV56966.1| GG22949 [Drosophila erecta]
          Length = 1427

 Score = 37.0 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 40/137 (29%), Gaps = 33/137 (24%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQY 92
             +  +  ++  +  +                 SD R K  +         + +  +   
Sbjct: 573 VFHTGRVGINTDRPDESLVVHGNLKVSGHIVQPSDSRAKQEIGELDTSVQLRNLQKIRIV 632

Query: 93  RYLSDPK--------------NVQRIGVIAQEISKIRPDTVVEN-----NQG-----IKS 128
           RY   P+               ++  GVIAQE+ ++ PD V E        G        
Sbjct: 633 RYRYMPEFAVHSGLRRESDTREIEDTGVIAQEVREVIPDAVQEAGSVVLPNGNVIEKFLL 692

Query: 129 VDYGRLFNIGQIQTKQK 145
           V+  R+        K+ 
Sbjct: 693 VNKDRILMENIGAVKEL 709


>gi|223940206|ref|ZP_03632067.1| Alpha-tubulin suppressor and related RCC1 domain-containing
           protein-like protein [bacterium Ellin514]
 gi|223891151|gb|EEF57651.1| Alpha-tubulin suppressor and related RCC1 domain-containing
           protein-like protein [bacterium Ellin514]
          Length = 649

 Score = 37.0 bits (84), Expect = 0.82,   Method: Composition-based stats.
 Identities = 21/166 (12%), Positives = 46/166 (27%), Gaps = 23/166 (13%)

Query: 1   MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
           +  +  + +     +           L N T +A +    +              G    
Sbjct: 454 VALRNGS-NVFQGTISAAGFTGDGSGLTNLTGVALLSGGNVFTGNQVISSGNVGIGNANP 512

Query: 61  YDAVNMG-----YQLAPLVSDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRI 104
            + + +             SDR +K +  PV             +  + Y + P     +
Sbjct: 513 TNILMVVNARCDGSSWINASDRNLKQDFAPVDAQTVLEKVAALPIQSWSYKAQPAQKH-V 571

Query: 105 GVIAQEISKIRPDTVVENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           G +AQ+        + ++   I +VD G    +     +      Q
Sbjct: 572 GPVAQDFHAAF--GLGQDETSIATVDEG---GVALAAIQGLNQKLQ 612


>gi|45550508|ref|NP_611893.3| CG3328 [Drosophila melanogaster]
 gi|45445679|gb|AAF47176.3| CG3328 [Drosophila melanogaster]
          Length = 1423

 Score = 37.0 bits (84), Expect = 0.96,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 40/137 (29%), Gaps = 33/137 (24%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQY 92
             +  +  ++  +  +                 SD R K  +         + +  +   
Sbjct: 574 VFHTGRVGINTDRPDESLVVHGNLKVSGHIVQPSDSRAKQEIGELDTSVQLRNLQKIRIV 633

Query: 93  RYLSDPK--------------NVQRIGVIAQEISKIRPDTVVEN-----NQG-----IKS 128
           RY   P+               ++  GVIAQE+ ++ PD V E        G        
Sbjct: 634 RYRYMPEFAVHSGLRRESDTREIEDTGVIAQEVREVIPDAVQEAGSVVLPNGNVIEKFLL 693

Query: 129 VDYGRLFNIGQIQTKQK 145
           V+  R+        K+ 
Sbjct: 694 VNKDRILMENIGAVKEL 710


>gi|313768280|ref|YP_004061960.1| hypothetical protein MpV1_077 [Micromonas sp. RCC1109 virus MpV1]
 gi|312598976|gb|ADQ91000.1| hypothetical protein MpV1_077 [Micromonas sp. RCC1109 virus MpV1]
          Length = 424

 Score = 37.0 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 23/68 (33%), Gaps = 14/68 (20%)

Query: 71  APLVSDRRMKCNVKPVA-----------NLYQYRYLSDPK---NVQRIGVIAQEISKIRP 116
               SD R+K N+  +               +Y Y+         Q  G IAQE+  + P
Sbjct: 204 ITNSSDERIKKNITDINDGDALNIIRLLQPKRYDYIDTKTAGTEGQVWGFIAQELEDVMP 263

Query: 117 DTVVENNQ 124
             V   + 
Sbjct: 264 YAVDTISD 271


>gi|194364667|ref|YP_002027277.1| hypothetical protein Smal_0889 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347471|gb|ACF50594.1| hypothetical protein Smal_0889 [Stenotrophomonas maltophilia
           R551-3]
          Length = 656

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/167 (9%), Positives = 39/167 (23%), Gaps = 23/167 (13%)

Query: 2   DQKQQAFH-EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60
            Q+    + +         +     S                     N L       +  
Sbjct: 479 TQRANFSNIQYRENTFVGGINSTGASAAFVIKDRGNANREFHIYNTDNVLRIWSSTAQGV 538

Query: 61  Y------DAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQYRYL--SDPKNVQR 103
                               S R++K                 L    Y    +    +R
Sbjct: 539 DRLTLTSAGALATSGGYDFGSSRKLKNIEGALPYGLAAVEQMELAAGHYKPEYNDDGRRR 598

Query: 104 IGVIAQEISKIRPDTVVENNQGIK-----SVDYGRLFNIGQIQTKQK 145
           +  +A++++++ P+ V       +     SV   +L  +     ++ 
Sbjct: 599 LFFVAEQLAEVVPEAVDLEGVEFQGERVASVKLDQLLPVMAKAIQEL 645


>gi|265763800|ref|ZP_06092368.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|263256408|gb|EEZ27754.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 1627

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 38/128 (29%), Gaps = 16/128 (12%)

Query: 18   VTVPKLPISL-NNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSD 76
             +     I + +N         +    +           G    +   +     +   SD
Sbjct: 1447 ASDNTFGIGVHSNDHMYWWWGTSTSTNSSSGKSYIMDYGGGNWSFTGNHYVSGYSTWGSD 1506

Query: 77   RRMK----------CNVKPVANLYQYRYLSDP---KNVQRIGVIAQEISKIRPDTVVENN 123
             R K            +     +Y YR+ S       +  +G  AQ   +I P+   + +
Sbjct: 1507 SRYKTYLGEVTLQLDQIADSPTIY-YRWNSKKRDRDGLLHVGGYAQYTEQILPELTHDTS 1565

Query: 124  QGIKSVDY 131
               K++DY
Sbjct: 1566 N-FKTMDY 1572


>gi|320168176|gb|EFW45075.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 1398

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 38/151 (25%), Gaps = 29/151 (19%)

Query: 24  PISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV 83
           P S        P + AG   +     ++  +                    SDRR+K  +
Sbjct: 773 PDSATALPAWGPGETAGSVAHFGNVGINTVRPSDALVVHGNVRVTGQVFQPSDRRVKDAI 832

Query: 84  KPVAN---LYQYR----YLSD------------PKNVQRIGVIAQEISKIRPDTVVENNQ 124
            PV     L        Y                      GV+AQE+ ++ P  V     
Sbjct: 833 VPVDTSEALRNVNSMRLYDYSLRPEWMETSHRPADQSTDRGVLAQELFELMPRAVNNIGD 892

Query: 125 ----------GIKSVDYGRLFNIGQIQTKQK 145
                         V+   +       T++ 
Sbjct: 893 VPLASGETIPDFLVVNKDAILMETVAATQEL 923


>gi|269792723|ref|YP_003317627.1| translation elongation factor G [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100358|gb|ACZ19345.1| translation elongation factor G [Thermanaerovibrio acidaminovorans
           DSM 6589]
          Length = 696

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/79 (15%), Positives = 25/79 (31%), Gaps = 14/79 (17%)

Query: 81  CNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDT-------VVENNQGIKS----- 128
             +  V +   Y Y  D       G + QE+ ++           +VE +  +       
Sbjct: 172 KGLVDVLSGKAYTYKGDGSKAFSEGPVPQELEEVVSSLRDSLVERIVEADDELMMRYLDG 231

Query: 129 --VDYGRLFNIGQIQTKQK 145
             + Y  L    +   +Q+
Sbjct: 232 EEIKYEELVPALRKAIRQR 250


>gi|220928942|ref|YP_002505851.1| hypothetical protein Ccel_1519 [Clostridium cellulolyticum H10]
 gi|219999270|gb|ACL75871.1| hypothetical protein Ccel_1519 [Clostridium cellulolyticum H10]
          Length = 1910

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 19/146 (13%), Positives = 40/146 (27%), Gaps = 18/146 (12%)

Query: 17   NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGK-KEFYDAVNMGYQLAPLVS 75
                     +  NP      D         +  +    +G  K      ++        S
Sbjct: 1752 GDHTHNTLYAKTNPIVNVSDDGYVGIGKTSETGIRLSVDGDIKAKTITGDIVATTLTQTS 1811

Query: 76   DRRMKCNVKPV---------ANLYQYRYLSDPK--NVQRIGVIAQEISKIRPDTVVENNQ 124
             R  K N+  +           L    +           IG IA+E+ +I        ++
Sbjct: 1812 SREFKENISALPLKTALDLLKKLNPVTFDYKNDSLKKHNIGFIAEEVPEIF------TSE 1865

Query: 125  GIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              KS+    +  +     K+++   +
Sbjct: 1866 DCKSIAVMDIVAVLTSVVKKQQTETK 1891


>gi|299747718|ref|XP_001837211.2| hypothetical protein CC1G_00347 [Coprinopsis cinerea okayama7#130]
 gi|298407648|gb|EAU84828.2| hypothetical protein CC1G_00347 [Coprinopsis cinerea okayama7#130]
          Length = 629

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 9/37 (24%), Positives = 16/37 (43%)

Query: 74  VSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQE 110
            +D R+K N+  +     + +   P+     G  AQE
Sbjct: 57  SADERLKSNLHRIFQERGFDFFEKPEKRTTDGTSAQE 93


>gi|291541167|emb|CBL14278.1| hypothetical protein RO1_40890 [Roseburia intestinalis XB6B4]
          Length = 835

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 40/126 (31%), Gaps = 15/126 (11%)

Query: 38  YAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ--LAPLVSDRRMKCNVKPVANL--YQYR 93
             G     +     +   G   F   V  G    +   +SD   K + + + +L    YR
Sbjct: 703 NKGGTDTDHCMINLDGDTGVAGFRGGVIDGSDKRMKNTISDLDKKRSSEFIYSLSAKSYR 762

Query: 94  YLSDPKNVQRIGVIAQEISK-------IRPDTVVENNQG--IKSVDYGRLFNIGQIQTKQ 144
           Y  +       G IAQ++ K       I P     ++ G     + Y  L        + 
Sbjct: 763 YNFERDGFHH-GFIAQDVLKKAEKGWNICPK-TFSDSNGKKYYGLKYTELIADLVATVQL 820

Query: 145 KKNTAQ 150
           + +  +
Sbjct: 821 QHDEIE 826


>gi|15837328|ref|NP_298016.1| hypothetical protein XF0726 [Xylella fastidiosa 9a5c]
 gi|9105614|gb|AAF83536.1|AE003915_1 hypothetical protein XF_0726 [Xylella fastidiosa 9a5c]
 gi|9107685|gb|AAF85284.1|AE004056_10 hypothetical protein XF_2486 [Xylella fastidiosa 9a5c]
          Length = 382

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 45/125 (36%), Gaps = 20/125 (16%)

Query: 39  AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKC-------NVKPVANLYQ 91
           +G +    + QL   ++          +        S R++K         +  +  L  
Sbjct: 244 SGGSGGTNEAQLMALEDNGNLSVKGTIVSAGGYAQGSSRKLKDIEGPLPYGLAEIEQLTP 303

Query: 92  Y--RYL--SDPKNVQRIGVIAQEISKIRPDTVVENNQGIK-------SVDYGRLFNIGQI 140
              RY     P   +R+ + A+++ ++ P+TV  N +G+        SV+  +L  +   
Sbjct: 304 LIGRYKPAYTPDGRRRLFLEAEQLLELMPETV--NPEGVHFQGAYVPSVNLDQLLPVLVN 361

Query: 141 QTKQK 145
              Q 
Sbjct: 362 AIAQL 366


>gi|61806169|ref|YP_214529.1| putative T4-like proximal tail fiber [Prochlorococcus phage P-SSM2]
 gi|61374678|gb|AAX44675.1| putative T4-like proximal tail fiber [Prochlorococcus phage P-SSM2]
 gi|265525377|gb|ACY76174.1| conserved hypothetical protein [Prochlorococcus phage P-SSM2]
          Length = 1094

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 22/181 (12%), Positives = 40/181 (22%), Gaps = 41/181 (22%)

Query: 10   EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ 69
               +            + +N T I      G + +   N  S            +     
Sbjct: 907  GYSNTAVGKWAGYFVNTGSNNTCIGYQSGTGSSPSGSVNSNSNVICLGDNSVQNIYCNDT 966

Query: 70   LAPLVSDRRMKCNVKP-------VANLYQYRYLS-------------------DPKNVQR 103
                 SD R K +++        +  L    Y                        N   
Sbjct: 967  SI-SSSDLRDKADIQNFDHGLAWIKELRPVTYRWDKRSWYTEDPATKGTPDGSKKTNRIH 1025

Query: 104  IGVIAQEISKIRPDTVVENN--------------QGIKSVDYGRLFNIGQIQTKQKKNTA 149
            +G IAQE  ++       +                    + Y RL  +     K+  +  
Sbjct: 1026 VGFIAQEAIEVEKKFGYGDKKDNMLITNQDEDDADPSYGMKYERLIPVLVNAIKELSSEI 1085

Query: 150  Q 150
             
Sbjct: 1086 D 1086


>gi|167647462|ref|YP_001685125.1| hypothetical protein Caul_3500 [Caulobacter sp. K31]
 gi|167349892|gb|ABZ72627.1| hypothetical protein Caul_3500 [Caulobacter sp. K31]
          Length = 899

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 31/118 (26%), Gaps = 20/118 (16%)

Query: 16  QNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYD------------- 62
               V               I   G  +      +     G                   
Sbjct: 729 GGTQVGGTLGVTGTLNCAGEIYTPGWIRLTGNQGMYWNAWGGGWTMTDSTWMRSYGDKSI 788

Query: 63  --AVNMGYQLAPLVSDRRMKCNVKPVAN----LYQYR-YLSDPKNVQRIGVIAQEISK 113
               N+   +  + SD R+K ++KP+ N    +Y    Y       +  GV+AQE   
Sbjct: 789 LTGGNIQCAMWTVTSDERLKTDIKPLTNGSEIIYGTNVYSFIKGGQRMWGVLAQEAQA 846


>gi|326633017|ref|YP_004306606.1| hypothetical protein SPC35_0123 [Enterobacteria phage SPC35]
 gi|321272211|gb|ADW80103.1| hypothetical protein SPC35_0123 [Enterobacteria phage SPC35]
          Length = 1116

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 37/131 (28%), Gaps = 22/131 (16%)

Query: 12   LSLMQNVTVPKLPISLNNPTPIAPIDYAG--------IAQNIYQNQLSERKEGKKEFYDA 63
              ++   ++      L           A              +    + R  G    +  
Sbjct: 902  SPIVSGGSLSAGGYHLRIGLGCISNGNAAWPDAALKLNGDGQFHRSFNFRTNGSVYTWGN 961

Query: 64   VNMGYQLAPL---VSDRRMKCNVKPVANL-----------YQYRYLSDPKNVQRIGVIAQ 109
               G          SDR +K ++     L             + Y  D  N  R GVIAQ
Sbjct: 962  DPWGGNYDFAMNPSSDRDIKRDINYDDGLASYENIKQFKPTTFIYKLDKYNRVRRGVIAQ 1021

Query: 110  EISKIRPDTVV 120
            ++ KI P+ V 
Sbjct: 1022 DLYKIDPEYVK 1032


>gi|77747606|ref|NP_299764.2| hypothetical protein XF2486 [Xylella fastidiosa 9a5c]
          Length = 530

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 45/125 (36%), Gaps = 20/125 (16%)

Query: 39  AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKC-------NVKPVANLYQ 91
           +G +    + QL   ++          +        S R++K         +  +  L  
Sbjct: 392 SGGSGGTNEAQLMALEDNGNLSVKGTIVSAGGYAQGSSRKLKDIEGPLPYGLAEIEQLTP 451

Query: 92  Y--RYL--SDPKNVQRIGVIAQEISKIRPDTVVENNQGIK-------SVDYGRLFNIGQI 140
              RY     P   +R+ + A+++ ++ P+TV  N +G+        SV+  +L  +   
Sbjct: 452 LIGRYKPAYTPDGRRRLFLEAEQLLELMPETV--NPEGVHFQGAYVPSVNLDQLLPVLVN 509

Query: 141 QTKQK 145
              Q 
Sbjct: 510 AIAQL 514


>gi|46409110|gb|AAS93712.1| RH07858p [Drosophila melanogaster]
          Length = 1423

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 40/137 (29%), Gaps = 33/137 (24%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV---------KPVANLYQY 92
             +  +  ++  +  +                 SD R K  +         + +  +   
Sbjct: 574 VFHTGRVGINTDRPDESLVVHGNLKVSGHIVQPSDSRAKQEIGELDTSVQLRNLQKIRIV 633

Query: 93  RYLSDPK--------------NVQRIGVIAQEISKIRPDTVVEN-----NQG-----IKS 128
           RY   P+               ++  GVIAQE+ ++ PD V E        G        
Sbjct: 634 RYRYMPEFAVHSGLRRESDTREIEDTGVIAQEVREVIPDVVQEAGSVVLPNGNVIEKFLL 693

Query: 129 VDYGRLFNIGQIQTKQK 145
           V+  R+        K+ 
Sbjct: 694 VNKDRILMENIGAVKEL 710


>gi|155370633|ref|YP_001426167.1| hypothetical protein FR483_N535L [Paramecium bursaria Chlorella virus
            FR483]
 gi|155123953|gb|ABT15820.1| hypothetical protein FR483_N535L [Paramecium bursaria Chlorella virus
            FR483]
          Length = 1293

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 17/116 (14%), Positives = 34/116 (29%), Gaps = 13/116 (11%)

Query: 21   PKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMK 80
                + +   +  A         N                  A           SDRR+K
Sbjct: 1136 NINSVFIGQNSVAAGRQNTVALCNGNNWVTLATNGDFVVPGAAYKPVAGSWLATSDRRLK 1195

Query: 81   CNVKPVA-----------NLYQYRYLSD--PKNVQRIGVIAQEISKIRPDTVVENN 123
             +++              +L  Y +      ++  ++G IAQE+ ++ P +V    
Sbjct: 1196 TDIQVANISRCEEIVRNLDLKHYAWTDVVPGEDRSQLGWIAQELEEVFPKSVKTKE 1251


>gi|28869296|ref|NP_791915.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|28871181|ref|NP_793800.1| tail fiber domain-containing protein [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|28852537|gb|AAO55610.1| tail fiber domain protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28854431|gb|AAO57495.1| tail fiber domain protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 475

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 30/106 (28%), Gaps = 15/106 (14%)

Query: 38  YAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL-------- 89
                 NIY    +    G  + Y   +    L  L SD R+K  V+  +          
Sbjct: 329 NGSRGANIYNLNWNTSNSGYVDVYIDASYVGALTLLQSDYRVKRQVEEFSAPFLERVNAY 388

Query: 90  YQYRYL-------SDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
               +                 G+IA E+ +I P         + +
Sbjct: 389 RIVTFKRAAYGEVFKDGENLIQGLIAHEVQEINPLAATGKKDDVDA 434


>gi|155122212|gb|ABT14080.1| hypothetical protein MT325_M526L [Paramecium bursaria chlorella virus
            MT325]
          Length = 1098

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/134 (11%), Positives = 41/134 (30%), Gaps = 17/134 (12%)

Query: 7    AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
              +   + +   ++     + +     +   +         N  +     +   +     
Sbjct: 923  TLNITNTHIFGDSITVGRSTNSVAIGRSSSVFGKQNLVSLCNSNNFVSLAENGDFTVPGA 982

Query: 67   G----YQLAPLVSDRRMKCNVKPVA-----------NLYQYRYLSD--PKNVQRIGVIAQ 109
                        SDRR+K +++              +L  Y +      ++  ++G IAQ
Sbjct: 983  AYKPVAGSWLATSDRRLKTDIQVANISRCEEIVRNLDLKHYDWTDAVPGEDRSQLGWIAQ 1042

Query: 110  EISKIRPDTVVENN 123
            E+ ++ P +V    
Sbjct: 1043 ELEEVFPKSVKTKE 1056


>gi|168236485|ref|ZP_02661543.1| hypothetical protein SeSB_A0853 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194735171|ref|YP_002113631.1| hypothetical protein SeSA_A0665 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194710673|gb|ACF89894.1| hypothetical protein SeSA_A0665 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197290318|gb|EDY29674.1| hypothetical protein SeSB_A0853 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 378

 Score = 35.8 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/147 (12%), Positives = 46/147 (31%), Gaps = 33/147 (22%)

Query: 34  APIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANL---- 89
           A ++   + +  Y             + D+  MG       SDR +K  ++ ++++    
Sbjct: 224 AGMNNLSLLRTGYFIDYESGPISL--YIDSTRMGEIQLSATSDRLLKKEIEYLSDMVGAD 281

Query: 90  ------------YQYRYLSD-----PKNVQRIGVIAQEISKIRPDTVVEN--NQGI---- 126
                           +        P++   +G IA ++ ++ P+ V       G     
Sbjct: 282 PSANALNEVLQWNPATFKYKKRSIIPESDTHLGFIANDLVEVSPECVKGKGLEDGYDENN 341

Query: 127 ----KSVDYGRLFNIGQIQTKQKKNTA 149
                S+D   +     +  ++ +   
Sbjct: 342 TAEAYSLDEIAMIAKLTLSIQELQKQI 368


>gi|326439167|ref|YP_004300297.1| hypothetical protein [Mavirus]
 gi|325485004|gb|ADZ16418.1| hypothetical protein [Mavirus]
          Length = 582

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 24/83 (28%), Gaps = 9/83 (10%)

Query: 56  GKKEFYDAVNMGYQLAPLVSDRRMKCNVKP-------VANLYQYRYLSDPK--NVQRIGV 106
           G   F              SD   K +V         +  L    Y       +    G+
Sbjct: 430 GYNTFRWKDVYSANGTIQTSDLNKKKDVNDLTKGLDFINTLRPVEYKFKENTSDRVHYGL 489

Query: 107 IAQEISKIRPDTVVENNQGIKSV 129
           IAQE+  +  +    +  G  +V
Sbjct: 490 IAQEVETVFNNLGDSDLTGNATV 512


>gi|330845115|ref|XP_003294445.1| hypothetical protein DICPUDRAFT_96050 [Dictyostelium purpureum]
 gi|325075090|gb|EGC29027.1| hypothetical protein DICPUDRAFT_96050 [Dictyostelium purpureum]
          Length = 1301

 Score = 35.4 bits (80), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/103 (15%), Positives = 30/103 (29%), Gaps = 21/103 (20%)

Query: 39  AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNV--------KPVANLY 90
                   +  ++     +    +   M        SD+R+K N+          +  L 
Sbjct: 815 PDSIYTNNKVGINTTTPSQALTVNGNIMVTGELFKPSDKRIKSNIKRDTTNHWDKINRLK 874

Query: 91  QYRYLSD-------------PKNVQRIGVIAQEISKIRPDTVV 120
            Y Y                   V+  G +AQE+  + P+ V 
Sbjct: 875 LYDYDRKKMMGYDDPNTSPNSNIVKEKGFLAQEVRDVMPNAVK 917


>gi|807598|gb|AAA66404.1| unknown protein [Paramecium bursaria Chlorella virus 1]
          Length = 292

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 16/108 (14%), Positives = 29/108 (26%), Gaps = 15/108 (13%)

Query: 31  TPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA--- 87
           +         +  N          +           G     + SD R+K ++       
Sbjct: 132 SGATQPGQLLLTTNGNLLLSGTVGDFTLVNGSGYKSGGGTWSVPSDMRLKNSITMANLHN 191

Query: 88  --------NLYQYRYLS----DPKNVQRIGVIAQEISKIRPDTVVENN 123
                   +L +Y           +   +G IAQ++ K  P  V   N
Sbjct: 192 CVEVIRQLDLKKYSLNDEVSTKITDKNVVGWIAQDVEKYIPKAVSVRN 239


>gi|109240501|ref|YP_654544.1| VP1 [Micromonas pusilla reovirus]
 gi|123811910|sp|Q1I0V1|VP1_MPRVN RecName: Full=Uncharacterized protein VP1
 gi|73918828|gb|AAZ94041.1| VP1 [Micromonas pusilla reovirus]
          Length = 1897

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/112 (16%), Positives = 39/112 (34%), Gaps = 13/112 (11%)

Query: 25   ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK 84
            ++  N   I+ I +      +    ++              +  Q   +VSD R+K N++
Sbjct: 1611 VTSGNTRYISYIGFQYNPSGLAAGIMAGTGNIVVSMKVLYAIECQRILVVSDERVKTNIR 1670

Query: 85   PVAN-----------LYQYRYLSDP--KNVQRIGVIAQEISKIRPDTVVENN 123
             V +             ++ Y+           G IAQ+I +  P+ V +  
Sbjct: 1671 DVNDHEALDIIRLIKPKKFEYIDKESAGPGTIYGFIAQDIIQHVPECVKKGP 1722


>gi|118352526|ref|XP_001009534.1| hypothetical protein TTHERM_00371040 [Tetrahymena thermophila]
 gi|89291301|gb|EAR89289.1| hypothetical protein TTHERM_00371040 [Tetrahymena thermophila
           SB210]
          Length = 1410

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/90 (14%), Positives = 31/90 (34%), Gaps = 8/90 (8%)

Query: 7   AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
           A + + + + N ++ +  +  +    I        AQN+   Q+   ++     +     
Sbjct: 413 AVNNLSTSINNASLGQKRVGSSPNITIERSGTPNKAQNLTNTQIIPGQQFPPGNHTQKIT 472

Query: 67  GYQLAPLVSDRRMKCNVKPVANLYQYRYLS 96
                      RMK NV  +  +  +R+  
Sbjct: 473 QK--------YRMKINVNDIEGISGFRFKF 494


>gi|116749060|ref|YP_845747.1| hypothetical protein Sfum_1625 [Syntrophobacter fumaroxidans MPOB]
 gi|116698124|gb|ABK17312.1| hypothetical protein Sfum_1625 [Syntrophobacter fumaroxidans MPOB]
          Length = 579

 Score = 35.4 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 38/143 (26%), Gaps = 22/143 (15%)

Query: 16  QNVTVPKLPISLNNPTP-IAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLV 74
             +        + NP+     +  AG      Q QL    +   +   A  +        
Sbjct: 415 AGMEQTNDYFRITNPSGGTLTMGRAGWLTLRSQTQLLFYLQNDGDLNIAGTLTQN----- 469

Query: 75  SDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENN 123
           SD   K N+ PV             +  + +  D    + +G +AQ+             
Sbjct: 470 SDVNSKENISPVDGQMVLSRLEQVPVTTWNFKGDDNAARHLGPMAQDFHAAF-----GLG 524

Query: 124 QGIKSVDYGRLFNIGQIQTKQKK 146
               S+       +     K+  
Sbjct: 525 NDNLSIAPMDATGVALAAIKELN 547


>gi|117924321|ref|YP_864938.1| hypothetical protein Mmc1_1014 [Magnetococcus sp. MC-1]
 gi|117608077|gb|ABK43532.1| hypothetical protein Mmc1_1014 [Magnetococcus sp. MC-1]
          Length = 381

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 31/90 (34%), Gaps = 6/90 (6%)

Query: 3   QKQQAFHEILSLMQNV-TVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
           Q+ Q  +E+ +++Q    +        +   +AP D  G  QN Y  Q+S     +    
Sbjct: 209 QRTQPMNELSAILQGSPAIQAPSFGAPSQYSVAPADVMGAIQNNYNAQVSAANSARAANA 268

Query: 62  DAVNMGYQLAPLV-----SDRRMKCNVKPV 86
                       +     S RR K +   +
Sbjct: 269 ATTGAVIGGLGAIGGAWISSRRFKQHFADL 298


>gi|67523859|ref|XP_659989.1| hypothetical protein AN2385.2 [Aspergillus nidulans FGSC A4]
 gi|74597471|sp|Q5BAP5|EGLX_EMENI RecName: Full=Endo-1,3(4)-beta-glucanase xgeA; AltName:
           Full=Mixed-linked glucanase xgeA; Flags: Precursor
 gi|40745340|gb|EAA64496.1| hypothetical protein AN2385.2 [Aspergillus nidulans FGSC A4]
 gi|259487788|tpe|CBF86736.1| TPA: GPI anchored endo-1,3(4)-beta-glucanase, putative
           (AFU_orthologue; AFUA_2G14360) [Aspergillus nidulans
           FGSC A4]
          Length = 626

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 9/71 (12%), Positives = 22/71 (30%), Gaps = 2/71 (2%)

Query: 69  QLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQG--I 126
            +A   S+ ++K + +    L  + +  +            +        V   + G   
Sbjct: 21  GIAHAASNYKLKESWEGEKILNHFHFFDNADPTNGFVTYVNQSYAESAGLVKTTDSGSLY 80

Query: 127 KSVDYGRLFNI 137
             VDY  +  +
Sbjct: 81  LGVDYENVLTV 91


>gi|302061780|ref|ZP_07253321.1| tail fiber domain protein [Pseudomonas syringae pv. tomato K40]
          Length = 457

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/138 (10%), Positives = 29/138 (21%), Gaps = 16/138 (11%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
                +    + N +   L +     +                           + Y   
Sbjct: 273 NNTAADYDVRLINDSAGTLTLDGRFGSKATWCRTGLNGSRGTTGYNFNWTGSYVDVYIDA 332

Query: 65  NMGYQLAPLVSDRRMKC---------NVKPVANLYQYRYL-------SDPKNVQRIGVIA 108
                +    SD R+K           +  +       Y            +    G+IA
Sbjct: 333 TYIGSMTLFQSDYRLKKYIKEFSAPSFLDRIDAYRIVTYQRKNFGDVFKGGSDVYQGLIA 392

Query: 109 QEISKIRPDTVVENNQGI 126
            E  ++ P        G+
Sbjct: 393 HEAKEVNPLAASGEKDGV 410


>gi|261601545|gb|ACX91148.1| FAD linked oxidase domain protein [Sulfolobus solfataricus 98/2]
          Length = 359

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 79  MKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY---GRLF 135
           +    +P++ +Y+     D   V  IG   + I KI  +   +   G  S+DY    ++ 
Sbjct: 207 LTSKYRPISIIYETDEKGDKTYVTFIGFR-RAIEKIGEEIGAKGEDGFYSIDYTSDEKVI 265

Query: 136 NIGQIQTKQ 144
           +I  ++ K+
Sbjct: 266 SIHTVRGKE 274


>gi|15899868|ref|NP_344473.1| glycolate oxidase glcE subunit. (glcE) [Sulfolobus solfataricus P2]
 gi|284174103|ref|ZP_06388072.1| glycolate oxidase glcE subunit. (glcE) [Sulfolobus solfataricus
           98/2]
 gi|13816595|gb|AAK43263.1| Glycolate oxidase glcE subunit. (glcE) [Sulfolobus solfataricus P2]
          Length = 382

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 79  MKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVDY---GRLF 135
           +    +P++ +Y+     D   V  IG   + I KI  +   +   G  S+DY    ++ 
Sbjct: 230 LTSKYRPISIIYETDEKGDKTYVTFIGFR-RAIEKIGEEIGAKGEDGFYSIDYTSDEKVI 288

Query: 136 NIGQIQTKQ 144
           +I  ++ K+
Sbjct: 289 SIHTVRGKE 297


>gi|284504278|ref|YP_003406993.1| hypothetical protein MAR_ORF257 [Marseillevirus]
 gi|282935716|gb|ADB04031.1| hypothetical protein MAR_ORF257 [Marseillevirus]
          Length = 80

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 95  LSDPKNVQRIGVIAQEISKIRPDTVVENNQGI-KSVDYGRLFNIGQIQTKQK 145
             +   V+  G++  E+ +I P+ VV+N +G    + +  L ++   + ++ 
Sbjct: 21  TYELGGVKDYGIVPSELEEIFPELVVKNAKGEAVGIRHLSLISLLLAEVQRL 72


>gi|293411904|ref|ZP_06654629.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291469459|gb|EFF11948.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 1385

 Score = 35.0 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 43/138 (31%), Gaps = 26/138 (18%)

Query: 39   AGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVAN--------LY 90
            +G +       +     G   + D       +    S RR K +++ + +        L 
Sbjct: 1237 SGGSGGFAIWDIGTTTSGANMYIDPNPGINTVWRSTSSRRYKKDIETLQDRYADELLSLR 1296

Query: 91   QYRYLSDPKNVQ----RIGVIAQEISKIRPDTVVENN------------QGI--KSVDYG 132
               Y S  +  +      G+IA+E+ +I P  V                 G+  + V Y 
Sbjct: 1297 PVWYRSICRGDRKDWGYYGLIAEEVGEIAPQYVHWREPTNNDSPEDISSNGMVAEGVMYE 1356

Query: 133  RLFNIGQIQTKQKKNTAQ 150
            RL        +Q     +
Sbjct: 1357 RLVVPLIHHIQQLTKRVE 1374


>gi|62362246|ref|YP_224171.1| gp33 [Enterobacteria phage ES18]
 gi|58339089|gb|AAW70504.1| gp33 [Enterobacteria phage ES18]
          Length = 378

 Score = 35.0 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 13/109 (11%), Positives = 35/109 (32%), Gaps = 31/109 (28%)

Query: 72  PLVSDRRMKCNVKPVANL----------------YQYRYLSD-----PKNVQRIGVIAQE 110
              SDR +K  ++ ++++                    +        P++   +G IA +
Sbjct: 260 SATSDRLLKKEIEYLSDMVGADPSANALNEVLQWNPATFKYKKRSIIPESDTHLGFIAND 319

Query: 111 ISKIRPDTVVEN--NQGI--------KSVDYGRLFNIGQIQTKQKKNTA 149
           + ++ P+ V       G          S+D   +     +  ++ +   
Sbjct: 320 LVEVSPECVKGKGLEDGYDENNTAEAYSLDEIAMIAKLTLSIQELQKQI 368


>gi|167515810|ref|XP_001742246.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778870|gb|EDQ92484.1| predicted protein [Monosiga brevicollis MX1]
          Length = 172

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 35/104 (33%), Gaps = 21/104 (20%)

Query: 35  PIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVA------- 87
            +  + +          +  E      +    G  L    SD R+K +++PV        
Sbjct: 67  GVANSVVHHGNVGINTDKPTEALSVHGNIRLTGTML--QTSDSRVKEDIQPVDTAEQLGN 124

Query: 88  ----NLYQYRYLSD--------PKNVQRIGVIAQEISKIRPDTV 119
                L +YR              + Q  GVIAQ++  + PD V
Sbjct: 125 IRRLELQRYRLKDAWADSIGRAADDRQETGVIAQQLETVLPDAV 168


>gi|225220124|ref|YP_002720091.1| putative tail tip protein [Enterobacteria phage SSL-2009a]
 gi|224986065|gb|ACN74629.1| putative tail tip protein [Enterobacteria phage SSL-2009a]
          Length = 505

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 14/73 (19%)

Query: 72  PLVSDRRMKCNVKPVANLYQYR---------YLSDPKNVQRIGVIAQEISKIRPDTVVEN 122
             +SDR +K  +K       Y          +     +VQR G+IAQ++++  P+ V   
Sbjct: 385 AALSDRDLKKEIKYTDGEESYNRVRQWLPAMFKYKESDVQRYGLIAQDLARTDPEYVHLL 444

Query: 123 N-----QGIKSVD 130
                 + +K VD
Sbjct: 445 PGYAIYEDVKGVD 457


>gi|167821736|ref|ZP_02453416.1| gp16 [Burkholderia pseudomallei 91]
          Length = 383

 Score = 35.0 bits (79), Expect = 3.5,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 42/134 (31%), Gaps = 12/134 (8%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q Q+       L    ++    +   +    + ++    AQ    +  S  +     + 
Sbjct: 181 TQAQEIAVGATGLHTQASLYLNGMGGLSYLGFSGLNNTVGAQLRISSNTSVAELQCVNYN 240

Query: 62  DAVNM--GYQLAPLVSDRRMKCNVKPVANL-------YQYRY--LSDPKNVQRIGVIAQE 110
                          SDR  K +++ + N+           Y   S P   ++ GVIA E
Sbjct: 241 ATTFGVLTASNFNQASDRAFKSDIQTLENVMARLRGKRGVTYLPKSSPGAGRQAGVIANE 300

Query: 111 ISKIRPDTVVENNQ 124
                P+ + E  +
Sbjct: 301 WRD-FPELLGEGPE 313


>gi|327409568|ref|YP_004346988.1| hypothetical protein LAU_0020 [Lausannevirus]
 gi|326784742|gb|AEA06876.1| conserved hypothetical protein [Lausannevirus]
          Length = 384

 Score = 35.0 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 40/150 (26%), Gaps = 20/150 (13%)

Query: 8   FHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMG 67
            + +++L                 P+                                + 
Sbjct: 243 INNVVALGSGT---------FAGAPVTDNTLVVDDTITQWRSFGMTFASSANTLQFDPVT 293

Query: 68  YQLAPLVSDRRMKCNVKPVAN-------LYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120
             +    S RR K N++                Y  D       GVIA+++ +    +  
Sbjct: 294 GLITQAASSRRFKENIREAGEEVPSLAEAKVCTY--DIDGRTDHGVIAEDVPEFYQCSDS 351

Query: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
           +   G+K++    +  +     K KK  AQ
Sbjct: 352 KGVNGVKTLR--VIMALLCEVQKLKKEIAQ 379


>gi|301306952|ref|ZP_07212995.1| hypothetical protein HMPREF9347_05545 [Escherichia coli MS 124-1]
 gi|300837846|gb|EFK65606.1| hypothetical protein HMPREF9347_05545 [Escherichia coli MS 124-1]
          Length = 114

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 17/62 (27%), Gaps = 19/62 (30%)

Query: 98  PKNVQRIGVIAQEISKIRPDTVV-------------------ENNQGIKSVDYGRLFNIG 138
                  GVIAQE+ +  P+ V                           +VDY  +  + 
Sbjct: 1   ENGAHCAGVIAQEVEEAIPEAVGSFIHYGEELQGPTVDGNELREETRYLNVDYAAVTGLL 60

Query: 139 QI 140
             
Sbjct: 61  VQ 62


>gi|66809965|ref|XP_638706.1| NDT80/PhoG-like protein [Dictyostelium discoideum AX4]
 gi|74854295|sp|Q54PT9|RCDK_DICDI RecName: Full=Protein rcdK
 gi|60467247|gb|EAL65280.1| NDT80/PhoG-like protein [Dictyostelium discoideum AX4]
          Length = 932

 Score = 35.0 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 38/117 (32%), Gaps = 13/117 (11%)

Query: 25  ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVK 84
            S +    I      GI        LS +               ++   +     K N+ 
Sbjct: 726 NSGDTEKSIVYNGKVGINVENPAYALSVQGTIYASEGVYHPSDLRIKYDLKSIDSKSNLD 785

Query: 85  PVANLYQYRYLSDPKNVQ-----------RIGVIAQEISKIRPDTVVENNQGIKSVD 130
            V  +  Y Y  +P+                GVIAQ++ +I P+ V     G K+V+
Sbjct: 786 NVNRMKLYDYKYNPQWTHMNGRDPYLDNCDRGVIAQDLQRILPNAVRTI--GNKNVN 840


>gi|225568841|ref|ZP_03777866.1| hypothetical protein CLOHYLEM_04920 [Clostridium hylemonae DSM
           15053]
 gi|225162340|gb|EEG74959.1| hypothetical protein CLOHYLEM_04920 [Clostridium hylemonae DSM
           15053]
          Length = 738

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 12/142 (8%), Positives = 41/142 (28%), Gaps = 3/142 (2%)

Query: 12  LSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQL- 70
           + +    +      ++      +P    G    +Y   ++          +   +  +  
Sbjct: 566 VKIQYGSSFGYPVSAVGAHVSASPNHQTGRRTPMYTRTVTAMAGTFGYELNLGALSGEEK 625

Query: 71  --APLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKS 128
                 +D   K         Y          +     ++++  K+  + V  +  G  +
Sbjct: 626 KEIRQQTDLYRKYAPLIQNGTYYRLSNPYEDEIGAWAFVSEDRRKVLLNAVTLDVHGNMT 685

Query: 129 VDYGRLFNIGQIQTKQKKNTAQ 150
           V+Y +   + +    +  ++ Q
Sbjct: 686 VNYIKPKGLKEDAVYEDMSSGQ 707


>gi|301115964|ref|XP_002905711.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262110500|gb|EEY68552.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 189

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 33/122 (27%), Gaps = 19/122 (15%)

Query: 8   FHEILSLMQNVTVPKLP------ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
                 L    T P  P       S         +          ++ L          +
Sbjct: 3   LTTTGRLGLGTTSPSAPLHVPGSNSFVFGAGGTTVYRLRTDSGATESALGPNTYSVAGIF 62

Query: 62  DAVNMGYQLAPLVSDRRMKCNV-----------KPVANLYQYRYLSDPKN-VQRIGVIAQ 109
               +      + SDRR+K N+                +  Y ++       Q IG+IAQ
Sbjct: 63  G-GYIACTAMAMTSDRRLKKNIQSCPIDRVKRLYDSCEVKLYDWIESENKPGQEIGLIAQ 121

Query: 110 EI 111
           ++
Sbjct: 122 DL 123


>gi|240145533|ref|ZP_04744134.1| cell wall surface anchor family protein [Roseburia intestinalis
           L1-82]
 gi|257202350|gb|EEV00635.1| cell wall surface anchor family protein [Roseburia intestinalis
           L1-82]
          Length = 559

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 15/117 (12%), Positives = 32/117 (27%), Gaps = 13/117 (11%)

Query: 20  VPKLPISLNNPTPIAPIDYA--GIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDR 77
           V  +   + N       D        N      +         +  + +        SD+
Sbjct: 358 VQGIRNRVTNRAMTITNDNHVRTYESNGVGMNGAISLGSANYRFSQLYVTSSSIST-SDK 416

Query: 78  RMKCNVKPV--------ANLYQYRYLSDPK--NVQRIGVIAQEISKIRPDTVVENNQ 124
             K ++K +          L    +L          IG IAQ++ +   +  + +  
Sbjct: 417 NYKDDIKSLTDKHLQFFMKLQPVSFLFKDGTSGRTHIGFIAQDVEQAMSECGLTDLD 473


>gi|37519819|ref|NP_923196.1| hypothetical protein gll0250 [Gloeobacter violaceus PCC 7421]
 gi|35210810|dbj|BAC88191.1| gll0250 [Gloeobacter violaceus PCC 7421]
          Length = 424

 Score = 34.7 bits (78), Expect = 4.3,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 36/115 (31%), Gaps = 13/115 (11%)

Query: 27  LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV 86
            +          A   +      ++            +  G     +VSDR +K N  PV
Sbjct: 249 SDQSAGDFSSTAAHQFRARASGGVTFFTNSAATVGATLAPGSGSWAVVSDRALKGNFTPV 308

Query: 87  ANLY-----------QYRYLSDPKNVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
             +             + Y S    V+ IG  AQ+        V E+ + I +VD
Sbjct: 309 DGVQVLEKLAALPIGTWNYTSQDPAVRHIGPTAQDFRAAF--AVGEDERHISTVD 361


>gi|296193920|ref|XP_002744734.1| PREDICTED: aminopeptidase Q-like [Callithrix jacchus]
          Length = 989

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 17/50 (34%), Gaps = 11/50 (22%)

Query: 96  SDPKNVQRIGVIAQEISKIRPDTVVENNQ-----------GIKSVDYGRL 134
                  +  V   + SK+ P+  V ++            G   V+Y +L
Sbjct: 615 WIKNGTTQSSVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKL 664


>gi|213967367|ref|ZP_03395515.1| tail fiber domain protein [Pseudomonas syringae pv. tomato T1]
 gi|302134255|ref|ZP_07260245.1| tail fiber domain protein [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213927668|gb|EEB61215.1| tail fiber domain protein [Pseudomonas syringae pv. tomato T1]
          Length = 477

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 14/138 (10%), Positives = 29/138 (21%), Gaps = 16/138 (11%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
                +    + N +   L +     +                           + Y   
Sbjct: 293 NNTAADYDVRLINDSAGTLTLDGRFGSKATWCRTGLNGSRGTTGYNFNWTGSYVDVYIDA 352

Query: 65  NMGYQLAPLVSDRRMKC---------NVKPVANLYQYRYL-------SDPKNVQRIGVIA 108
                +    SD R+K           +  +       Y            +    G+IA
Sbjct: 353 TYIGSMTLFQSDYRLKKYIKEFSAPSFLDRIDAYRIVTYQRKNFGDVFKGGSDVYQGLIA 412

Query: 109 QEISKIRPDTVVENNQGI 126
            E  ++ P        G+
Sbjct: 413 HEAKEVNPLAASGEKDGV 430


>gi|301382058|ref|ZP_07230476.1| tail fiber domain protein [Pseudomonas syringae pv. tomato Max13]
          Length = 459

 Score = 34.7 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 14/138 (10%), Positives = 29/138 (21%), Gaps = 16/138 (11%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
                +    + N +   L +     +                           + Y   
Sbjct: 293 NNTAADYDVRLINDSAGTLTLDGRFGSKATWCRTGLNGSRGTTGYNFNWTGSYVDVYIDA 352

Query: 65  NMGYQLAPLVSDRRMKC---------NVKPVANLYQYRYL-------SDPKNVQRIGVIA 108
                +    SD R+K           +  +       Y            +    G+IA
Sbjct: 353 TYIGSMTLFQSDYRLKKYIKEFSAPSFLDRIDAYRIVTYQRKNFGDVFKGGSDVYQGLIA 412

Query: 109 QEISKIRPDTVVENNQGI 126
            E  ++ P        G+
Sbjct: 413 HEAKEVNPLAASGEKDGV 430


>gi|134277019|ref|ZP_01763734.1| gp16 [Burkholderia pseudomallei 305]
 gi|134250669|gb|EBA50748.1| gp16 [Burkholderia pseudomallei 305]
          Length = 341

 Score = 34.7 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 44/134 (32%), Gaps = 12/134 (8%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
            Q Q+       L    ++    +   +    + ++    AQ    +  S  +     + 
Sbjct: 141 TQAQEIAVGATGLHTQASLYLNGMGGLSYLGFSGLNNTVGAQFRISSNTSVAELQCVNYN 200

Query: 62  DAVNM--GYQLAPLVSDRRMKCNVKPVANL-------YQYRY--LSDPKNVQRIGVIAQE 110
                          SDR  K +++ + N+           +   ++P+  ++ GVIA E
Sbjct: 201 ATTFGVLTASNFNQASDRAFKSDIQTLENVMARLRGKRGVTFLQKNNPEAGRQAGVIANE 260

Query: 111 ISKIRPDTVVENNQ 124
                P+ + E  +
Sbjct: 261 WWD-FPELLGEGPE 273


>gi|301106534|ref|XP_002902350.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262098970|gb|EEY57022.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 189

 Score = 34.7 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 38/142 (26%), Gaps = 26/142 (18%)

Query: 8   FHEILSLMQNVTVPKLP------ISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
                 L    T P  P       S         +          ++ L          +
Sbjct: 3   LTTTGRLGLGTTSPSAPLHVPGSNSFVFGAGGTTVYRLRTDSGATESALGPITYSVAGIF 62

Query: 62  DAVNMGYQLAPLVSDRRMKCNV-----------KPVANLYQYRYLSDPKN-VQRIGVIAQ 109
               +      + SDRR+K N+                +  Y ++       Q IG+IAQ
Sbjct: 63  G-GYIACTAMAMTSDRRLKKNIQSCPIDRVKRLYDSCEVKLYDWIESENKPGQEIGLIAQ 121

Query: 110 EISKIRPDTVVENNQGIKSVDY 131
                  D V  +   + S+ Y
Sbjct: 122 -------DLVSAHLTDLISIFY 136


>gi|317048326|ref|YP_004115974.1| hypothetical protein Pat9b_2106 [Pantoea sp. At-9b]
 gi|316949943|gb|ADU69418.1| conserved hypothetical protein [Pantoea sp. At-9b]
          Length = 423

 Score = 34.3 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 22/174 (12%), Positives = 54/174 (31%), Gaps = 32/174 (18%)

Query: 7   AFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM 66
             +   SL     + ++          +   +A                    +    N 
Sbjct: 229 TVNFASSLTTGGGMFRVNNGGYCCKAGSTGAFASYVY-NMNWVNPGSGSQMALYVGTTNT 287

Query: 67  GYQLAPLVSDRRMKCNVKPV--------------ANLYQYRYLS---DPKNVQRIGVIAQ 109
           GY      SDR++K ++  +                +  +RY +     ++++++G IA 
Sbjct: 288 GYITTTSTSDRQLKKDITYLESSAPDDTLAEVLKWKVASFRYKARGIIEESIEKLGFIAN 347

Query: 110 EISKIRPDTVVE-----------NNQGI---KSVDYGRLFNIGQIQTKQKKNTA 149
           ++ ++ P TV             +  GI    ++D   L     +  + ++   
Sbjct: 348 DLVEVSPQTVTGNGLPEDYDIEADPNGIGDAYALDQVALIAKLTMAVQAQQQLI 401


>gi|330840721|ref|XP_003292359.1| hypothetical protein DICPUDRAFT_89788 [Dictyostelium purpureum]
 gi|325077395|gb|EGC31110.1| hypothetical protein DICPUDRAFT_89788 [Dictyostelium purpureum]
          Length = 779

 Score = 34.3 bits (77), Expect = 5.7,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 38/109 (34%), Gaps = 22/109 (20%)

Query: 42  AQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV---------ANLYQY 92
                +  ++    G            +     SD R+K ++KPV           +  Y
Sbjct: 562 IVYNGKVGINVDNPGFALSVQGTIYASEGVFHPSDLRIKHDLKPVEPRQSLENVNRMRLY 621

Query: 93  RYLSDPK-----------NVQRIGVIAQEISKIRPDTVVENNQGIKSVD 130
            +  +P+           +    GVIAQE+ +I P  V     G K+V+
Sbjct: 622 DFKYNPQWSYLNGKDPYVDSNDRGVIAQELQQIIPSAVRTI--GNKNVN 668


>gi|327282413|ref|XP_003225937.1| PREDICTED: hypothetical protein LOC100566577 [Anolis carolinensis]
          Length = 367

 Score = 34.3 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 9/68 (13%), Positives = 26/68 (38%), Gaps = 4/68 (5%)

Query: 60  FYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIR---P 116
            +  ++  + +    S++ +K N   +     + +         +G+I   ++K+    P
Sbjct: 143 NHHVMSALFAIYSSHSEKPLKSNNIAIVKTNHFTWNHKSSGGDIMGLI-DVLTKMLRHSP 201

Query: 117 DTVVENNQ 124
             V E+  
Sbjct: 202 VAVREDTD 209


>gi|18203671|sp|Q9ZA21|HGPA_HAEIN RecName: Full=Hemoglobin and hemoglobin-haptoglobin-binding protein
           A; AltName: Full=Heme-repressible hemoglobin-binding
           protein; Short=Hgb; Flags: Precursor
 gi|4204775|gb|AAD10835.1| hemoglobin and hemoglobin-haptoglobin binding protein [Haemophilus
           influenzae]
          Length = 1077

 Score = 33.9 bits (76), Expect = 7.5,   Method: Composition-based stats.
 Identities = 12/91 (13%), Positives = 25/91 (27%), Gaps = 2/91 (2%)

Query: 5   QQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAV 64
            Q  ++  +   N    +      N     P +      +    QL +            
Sbjct: 32  NQPTNQPTNQPTNQPTNQPTNQPTNQPTNQPTNQPTNQNSNASEQLEQINVSGSTENTDT 91

Query: 65  NMGYQLAPLVSDRR--MKCNVKPVANLYQYR 93
               ++A  V   +   K   + V +L +Y 
Sbjct: 92  KAPPKIAETVKTAKKLEKEQAQDVKDLVRYE 122


>gi|298709013|emb|CBJ30964.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 3146

 Score = 33.9 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 42/111 (37%), Gaps = 18/111 (16%)

Query: 27   LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV 86
              N      ID        Y  +L + + G+     +V +        SD R+K ++  V
Sbjct: 1973 ATNNVIGFSIDNPMDDNVEYDFRLQQFEGGESRVVSSVPLQVTTIEYSSDERIKESIIDV 2032

Query: 87   A-----------NLYQYRYLSD-------PKNVQRIGVIAQEISKIRPDTV 119
                         + +Y Y  +        +N +  GVIAQ+++++ P+ V
Sbjct: 2033 DVDDVLQRFMEVEMVEYAYTEEWRQARNLGENARVRGVIAQQLAEVFPEHV 2083



 Score = 33.9 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 22/111 (19%), Positives = 42/111 (37%), Gaps = 18/111 (16%)

Query: 27   LNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPV 86
              N      ID        Y  +L + + G+     +V +        SD R+K ++  V
Sbjct: 2318 ATNNVIGFSIDNPMDDNVEYDFRLQQFEGGESRVVSSVPLQVTTIEYSSDERIKESIIDV 2377

Query: 87   A-----------NLYQYRYLSD-------PKNVQRIGVIAQEISKIRPDTV 119
                         + +Y Y  +        +N +  GVIAQ+++++ P+ V
Sbjct: 2378 DVDDVLQRFMEVEMVEYAYTEEWRQARNLGENARVRGVIAQQLAEVFPEHV 2428


>gi|260597556|ref|YP_003210127.1| hypothetical protein CTU_17640 [Cronobacter turicensis z3032]
 gi|260216733|emb|CBA30134.1| unknown protein [Cronobacter turicensis z3032]
          Length = 178

 Score = 33.9 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 21/112 (18%), Positives = 36/112 (32%), Gaps = 14/112 (12%)

Query: 29  NPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNM--GYQLAPLVSDRRMKCN---- 82
             +      YA      Y +        +                  VSD R+K      
Sbjct: 2   AFSNSNFSSYALQISGTYNSASRYFARSQNGDNGGAWQPWREFTMAAVSDERLKDVKGSF 61

Query: 83  --VKPVANLYQ-----YRYLS-DPKNVQRIGVIAQEISKIRPDTVVENNQGI 126
                + N+ +     +RY    P+   R GVIAQ+I +I  + V +  + +
Sbjct: 62  NVEAGLDNINRMEFKLFRYKWDKPERSARRGVIAQQIMQIDKEYVKDVGENM 113


>gi|38640370|ref|NP_944293.1| Bcep22gp64 [Burkholderia phage Bcep22]
 gi|33860437|gb|AAQ54997.1| Bcep22gp64 [Burkholderia phage Bcep22]
          Length = 425

 Score = 33.9 bits (76), Expect = 8.5,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 53/152 (34%), Gaps = 18/152 (11%)

Query: 17  NVTVPKLPISLNNPTPIAPIDYAG-IAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVS 75
           N +V    +S    T +A    +G   + +  N  +   +      +    G  +  +VS
Sbjct: 263 NGSVWGGLLSDYLATQLAGKQASGNYMRGVTGNGFTVGWDSGANHLNFFVDGNLVGFVVS 322

Query: 76  DRRMKCNVKPVA----------NLYQYRYLSD---PKNVQRIGVIAQEISKIRPDTVVE- 121
           D R K N+ P +             ++ ++     PK     GVIAQ+  +I P+ + + 
Sbjct: 323 DERAKKNITPSSTDALARVKALEFVEFDFIDSPYLPKKHVDNGVIAQQAQRINPNWIDKP 382

Query: 122 ---NNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150
              +      ++   L        +Q  +   
Sbjct: 383 PADHPDAYLGLNLQYLLMDAMRAIQQLSSEVD 414


>gi|226229168|ref|YP_002763274.1| hypothetical protein GAU_3762 [Gemmatimonas aurantiaca T-27]
 gi|226092359|dbj|BAH40804.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 603

 Score = 33.5 bits (75), Expect = 8.8,   Method: Composition-based stats.
 Identities = 12/125 (9%), Positives = 27/125 (21%), Gaps = 15/125 (12%)

Query: 2   DQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFY 61
                  + I+  +       + ++         +                     +   
Sbjct: 408 ANTNYQANAIV--LSASQ--SMGVAKALADGHFVMQGYRFWMGNGPQTAITPGRFLETST 463

Query: 62  DAVNMGYQLAPLVSDRRMKCNVKPVAN-----------LYQYRYLSDPKNVQRIGVIAQE 110
            A           SD   K N + V             +Y + Y ++    + +G  AQ 
Sbjct: 464 GAYLSTGGTWTNTSDSTKKANFRAVDGESVLSTLAALPVYTWNYTAEDTTTRHMGPTAQA 523

Query: 111 ISKIR 115
                
Sbjct: 524 FRAAF 528


>gi|313238224|emb|CBY13316.1| unnamed protein product [Oikopleura dioica]
          Length = 362

 Score = 33.5 bits (75), Expect = 9.8,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 32/84 (38%)

Query: 10  EILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQ 69
           ++ +LM +V       + +  T          A N Y N +   +   K+F + +N G  
Sbjct: 141 DLSALMNSVADNNFQNAQDAATSYEAQTDYTNASNAYLNSMRALRSAFKQFNNGINNGRN 200

Query: 70  LAPLVSDRRMKCNVKPVANLYQYR 93
            A  +SD  M       A LY Y 
Sbjct: 201 TAEQLSDYAMLAFEFFEAGLYVYE 224


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.314    0.133    0.349 

Lambda     K      H
   0.267   0.0403    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,132,544,464
Number of Sequences: 14124377
Number of extensions: 39361928
Number of successful extensions: 137664
Number of sequences better than 10.0: 1249
Number of HSP's better than 10.0 without gapping: 586
Number of HSP's successfully gapped in prelim test: 663
Number of HSP's that attempted gapping in prelim test: 135708
Number of HSP's gapped (non-prelim): 1974
length of query: 150
length of database: 4,842,793,630
effective HSP length: 113
effective length of query: 37
effective length of database: 3,246,739,029
effective search space: 120129344073
effective search space used: 120129344073
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 75 (33.5 bits)