RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62] (150 letters) >gnl|CDD|147258 pfam04989, CmcI, Cephalosporin hydroxylase. Members of this family are about 220 amino acids long. The CmcI protein is presumed to represent the cephalosporin-7--hydroxylase. However this has not been experimentally verified. Length = 202 Score = 28.0 bits (63), Expect = 1.0 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Query: 88 NLYQYRYLSDP--KNVQRIGVIAQE-ISKIRPDTVVE 121 Y +R+L P K Q + V QE I +++PD ++E Sbjct: 3 YSYNFRWLGRPIIKLPQDM-VAYQELIWELKPDLIIE 38 >gnl|CDD|38865 KOG3661, KOG3661, KOG3661, Uncharacterized conserved protein [Function unknown]. Length = 1019 Score = 26.6 bits (58), Expect = 2.9 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 103 RIGVIAQEISKIRPDTVVENNQGIKSVDYGRLF--NIGQIQ 141 R GVIAQE+ + PD V + + +V+ R+F +G Q Sbjct: 532 RTGVIAQELKAVLPDAVKDTGDYL-TVNEERVFYETVGATQ 571 >gnl|CDD|36346 KOG1131, KOG1131, KOG1131, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription, Replication, recombination and repair]. Length = 755 Score = 25.7 bits (56), Expect = 6.0 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 10/39 (25%) Query: 85 PVAN--LYQYRYLSDPKNVQRIGVIAQEISK-IRPDTVV 120 P AN +Y Y YL DPK IA+ +SK + ++VV Sbjct: 198 PFANVIVYSYHYLLDPK-------IAELVSKELSKESVV 229 >gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 933 Score = 25.2 bits (55), Expect = 8.0 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 43 QNIYQNQLSERKEGKKEFY 61 +IY+ ER +GK +F Sbjct: 34 NDIYEKIREERNKGKPKFV 52 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.133 0.371 Gapped Lambda K H 0.267 0.0766 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,718,609 Number of extensions: 81562 Number of successful extensions: 137 Number of sequences better than 10.0: 1 Number of HSP's gapped: 137 Number of HSP's successfully gapped: 10 Length of query: 150 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 65 Effective length of database: 4,426,972 Effective search space: 287753180 Effective search space used: 287753180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (24.1 bits)