RPSBLAST alignment of GI: 254781131 and MMDB domain: 3gud_A_

>3gud_A (A:) NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1}Length = 129
 Score = 36.2 bits (83), Expect = 0.002
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 15/62 (24%)

Query: 75  SDRRMKCNVKPVAN----------LYQYRYLSD-----PKNVQRIGVIAQEISKIRPDTV 119
           SD R K ++ P+++           YQY++         +     GVIAQ+I K+  D  
Sbjct: 1   SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEG 60

Query: 120 VE 121
           + 
Sbjct: 61  LS 62