BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62] (150 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781131|ref|YP_003065544.1| hypothetical protein CLIBASIA_05165 [Candidatus Liberibacter asiaticus str. psy62] Length = 150 Score = 306 bits (784), Expect = 1e-85, Method: Compositional matrix adjust. Identities = 150/150 (100%), Positives = 150/150 (100%) Query: 1 MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60 MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF Sbjct: 1 MDQKQQAFHEILSLMQNVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKEGKKEF 60 Query: 61 YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120 YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV Sbjct: 61 YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLSDPKNVQRIGVIAQEISKIRPDTVV 120 Query: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ Sbjct: 121 ENNQGIKSVDYGRLFNIGQIQTKQKKNTAQ 150 >gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 27.7 bits (60), Expect = 0.086, Method: Compositional matrix adjust. Identities = 19/56 (33%), Positives = 27/56 (48%) Query: 36 IDYAGIAQNIYQNQLSERKEGKKEFYDAVNMGYQLAPLVSDRRMKCNVKPVANLYQ 91 ID ++ I QN+L E K+ V +G+ LVSDR M V +LY+ Sbjct: 80 IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135 >gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 442 Score = 23.9 bits (50), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Query: 61 YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLS----DPKNVQRIGVIAQEISKIRP 116 YD V + Y PLVS +K + +A Y + +PK R+ + EI IR Sbjct: 98 YDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIRE 157 Query: 117 D 117 + Sbjct: 158 E 158 >gi|254780217|ref|YP_003064630.1| DNA polymerase III subunit delta' [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Score = 23.9 bits (50), Expect = 1.4, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 14 LMQNVTVPKLPISLNNPTPIAPI 36 ++QN K P+ + NP P +P Sbjct: 58 VLQNPDFSKAPVRMCNPDPCSPF 80 >gi|254780464|ref|YP_003064877.1| M16 family peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 23.5 bits (49), Expect = 2.0, Method: Compositional matrix adjust. Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 17 NVTVPKLPISLNNPTPIAPIDYAGIAQNIYQNQLSERKE 55 N+ + K + T + PID A + NI +ER+E Sbjct: 2 NLRISKTSSGITVITEVMPIDSAFVKVNIRAGSRNERQE 40 >gi|254780836|ref|YP_003065249.1| putative type I restriction-modification system DNA methylase [Candidatus Liberibacter asiaticus str. psy62] Length = 674 Score = 22.7 bits (47), Expect = 2.9, Method: Composition-based stats. Identities = 8/36 (22%), Positives = 19/36 (52%) Query: 61 YDAVNMGYQLAPLVSDRRMKCNVKPVANLYQYRYLS 96 + + G + P RR++C ++P + + +YL+ Sbjct: 26 FKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLA 61 >gi|254780507|ref|YP_003064920.1| hypothetical protein CLIBASIA_01970 [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 21.6 bits (44), Expect = 6.0, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 69 QLAPLVSDRRMKCNVKPVANLYQYRYLSDP 98 +L+ +V+D + + +K +A Y Y LS P Sbjct: 68 KLSFIVNDSQERSYLKEIATDYLYTLLSGP 97 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.133 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,268 Number of Sequences: 1233 Number of extensions: 3599 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 8 length of query: 150 length of database: 328,796 effective HSP length: 67 effective length of query: 83 effective length of database: 246,185 effective search space: 20433355 effective search space used: 20433355 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 34 (17.7 bits)