RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781134|ref|YP_003065547.1| hypothetical protein CLIBASIA_05180 [Candidatus Liberibacter asiaticus str. psy62] (320 letters) >gnl|CDD|184752 PRK14573, PRK14573, bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional. Length = 809 Score = 28.6 bits (64), Expect = 2.2 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 11/59 (18%) Query: 171 FFGDYEGTFWQGD---ISGSDNARPFIGIYLSPFHAIDPRLGFQRRACVAHLSLQAYQR 226 FF D EG FW + I G A PF+ ++ R G+ V L + + Sbjct: 739 FFLDEEGNFWLSEMNPIPGMTEASPFLTAFV--------RKGWTYEQIVHQLIIDGLHK 789 >gnl|CDD|163400 TIGR03688, pupylate_PafA2, proteasome accessory factor PafA2. This protein family is paralogous to (and distinct from) the PafA (proteasome accessory factor) first described in Mycobacterium tuberculosis (see TIGR03686). Members of both this family and TIGR03686 itself tend to cluster with each other, with the ubiquitin analog Pup (TIGR03687) associated with targeting to the proteasome, and with proteasome subunits themselves. Length = 485 Score = 27.8 bits (62), Expect = 3.5 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 233 ARANYDHSYPEFSKETISNNPMDNGIWD 260 AR DH++PE+S ++ NP D ++D Sbjct: 89 ARFYVDHAHPEYSSPEVT-NPRDAVLYD 115 >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 1042 Score = 28.0 bits (62), Expect = 3.7 Identities = 6/28 (21%), Positives = 13/28 (46%) Query: 81 ISMKNILLQEEKTNLPLSWPIQEQWEQA 108 ++ LL+E +T++ + E A Sbjct: 699 LAQCQTLLRELETHIEEYDREFNEIENA 726 >gnl|CDD|128425 smart00115, CASc, Caspase, interleukin-1 beta converting enzyme (ICE) homologues. Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues. Length = 241 Score = 26.8 bits (60), Expect = 7.7 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Query: 11 FSWSTESGDGLSTLCVFLSTLGEVAVYGGDNPDDSSSFSLKAIYHI 56 F+ E D S +CV LS E +YG D S L I+ + Sbjct: 64 FAERPEHSDSDSFVCVLLSHGEEGGIYG----TDHSPLPLDEIFSL 105 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.135 0.432 Gapped Lambda K H 0.267 0.0656 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,233,142 Number of extensions: 324038 Number of successful extensions: 491 Number of sequences better than 10.0: 1 Number of HSP's gapped: 491 Number of HSP's successfully gapped: 7 Length of query: 320 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 227 Effective length of database: 3,984,929 Effective search space: 904578883 Effective search space used: 904578883 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 57 (25.9 bits)