RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781135|ref|YP_003065548.1| hypothetical protein CLIBASIA_05185 [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 336 Score = 24.9 bits (53), Expect = 1.6 Identities = 10/47 (21%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Query: 37 KSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL 83 K P+ C G NP+ + G K+ + A +M + ++ Sbjct: 41 KVPAKPVNCMGLTFKNPLGLAAG-LDKDGECIDALGAMGFGSIEIGT 86 >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Score = 23.9 bits (51), Expect = 3.3 Identities = 9/51 (17%), Positives = 15/51 (29%) Query: 15 DKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNR 65 D +F+ L + + + C H Y + W KN Sbjct: 473 DTSFVEKLIQEQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKNM 523 >d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Score = 23.6 bits (51), Expect = 4.3 Identities = 4/17 (23%), Positives = 7/17 (41%) Query: 54 VYFSYGWFFKNRQWYIA 70 Y S W + ++A Sbjct: 88 TYASAKWTHSGGEMFVA 104 >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Score = 23.1 bits (49), Expect = 6.8 Identities = 4/24 (16%), Positives = 9/24 (37%), Gaps = 3/24 (12%) Query: 44 ICAGHNQNNPVYFSYGWFFKNRQW 67 + Q +Y ++ + QW Sbjct: 81 VVDDLGQKITLYLNF---VEKVQW 101 >d1nuna_ b.42.1.1 (A:) Fibroblast growth factor-10, FGF10 {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Score = 22.9 bits (49), Expect = 6.8 Identities = 7/17 (41%), Positives = 9/17 (52%) Query: 54 VYFSYGWFFKNRQWYIA 70 Y S+ W RQ Y+A Sbjct: 95 TYASFNWQHNGRQMYVA 111 >d1qh4a2 d.128.1.2 (A:103-381) Creatine kinase, C-terminal domain {Chicken (Gallus gallus), brain-type [TaxId: 9031]} Length = 279 Score = 22.6 bits (48), Expect = 8.6 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 11 YTTPDKTFLIALNGQD 26 + +KTFL+ +N +D Sbjct: 116 WHNDNKTFLVWINEED 131 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.135 0.461 Gapped Lambda K H 0.267 0.0393 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 336,440 Number of extensions: 12649 Number of successful extensions: 43 Number of sequences better than 10.0: 1 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 13 Length of query: 83 Length of database: 2,407,596 Length adjustment: 49 Effective length of query: 34 Effective length of database: 1,734,826 Effective search space: 58984084 Effective search space used: 58984084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.8 bits)