RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781136|ref|YP_003065549.1| hypothetical protein CLIBASIA_05190 [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >gnl|CDD|161807 TIGR00292, TIGR00292, thiazole biosynthesis enzyme. This enzyme is involved in the biosynthesis of the thiamine precursor thiazole, and is repressed by thiamine.This family includes c-thi1, a Citrus gene induced during natural and ethylene induced fruit maturation and is highly homologous to plant and yeast thi genes involved in thiamine biosynthesis. Length = 254 Score = 25.6 bits (56), Expect = 2.7 Identities = 11/56 (19%), Positives = 18/56 (32%) Query: 54 GPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATV 109 I+ +KI D + S + + N RE+ + M A V Sbjct: 170 AEIVAVCAKKIVLEDQVPKLGGEKSMWAEVAEVAIHENTREVVPNLYVAGMAVAAV 225 >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1 the former of which is modelled by TIGR01116. Length = 884 Score = 24.8 bits (54), Expect = 4.6 Identities = 10/50 (20%), Positives = 20/50 (40%) Query: 61 CRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVC 110 KI T D ++++A S + V Y V + +++ +C Sbjct: 342 VTKIWTSDGLHTMLNAVSLNQFGEVIVDGDVLHGFYTVAVSRILEAGNLC 391 >gnl|CDD|119131 pfam10611, DUF2469, Protein of unknown function (DUF2469). Member proteins often found in Actinomycetes clustered with signal peptidase and/or RNAse-HII. Length = 101 Score = 25.1 bits (55), Expect = 4.7 Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 73 IISAFSYRSSTQQRVFLANHREI 95 ++ FSY T++R +LAN ++ Sbjct: 24 VVGLFSYVVETERRFYLANSVDL 46 >gnl|CDD|184979 PRK15018, PRK15018, 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional. Length = 245 Score = 24.6 bits (53), Expect = 5.9 Identities = 11/29 (37%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Query: 87 VFLANHREIYD-VTDASSMQSATVCVCRE 114 +++ANH+ YD VT ++ +Q TV V ++ Sbjct: 68 IYIANHQNNYDMVTASNIVQPPTVTVGKK 96 >gnl|CDD|183257 PRK11649, PRK11649, putative peptidase; Provisional. Length = 439 Score = 24.2 bits (53), Expect = 7.6 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 12/50 (24%) Query: 7 NQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPI 56 +++D N S + FL FPT KQ F I NF P P+ Sbjct: 269 GKFYDRNG------SGLAKGFLRFPTAKQ------FRISSNFNPRRLNPV 306 >gnl|CDD|119073 pfam10553, MSV199, MSV199 domain. This domain was identified by Iyer and colleagues. Length = 135 Score = 24.2 bits (53), Expect = 8.9 Identities = 7/34 (20%), Positives = 16/34 (47%) Query: 14 NLSGEYISSKDQNFLYFPTEKQQLQENAFSILHN 47 N S +I++ ++ + E + ++N IL Sbjct: 29 NNSNVHITTSILEWIGYEGEFRNQKKNFKKILKR 62 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.130 0.386 Gapped Lambda K H 0.267 0.0606 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,644,648 Number of extensions: 81357 Number of successful extensions: 152 Number of sequences better than 10.0: 1 Number of HSP's gapped: 152 Number of HSP's successfully gapped: 18 Length of query: 114 Length of database: 5,994,473 Length adjustment: 79 Effective length of query: 35 Effective length of database: 4,287,441 Effective search space: 150060435 Effective search space used: 150060435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.3 bits)