RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781136|ref|YP_003065549.1| hypothetical protein CLIBASIA_05190 [Candidatus Liberibacter asiaticus str. psy62] (114 letters) >d2caya1 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 130 Score = 22.9 bits (49), Expect = 6.6 Identities = 7/21 (33%), Positives = 10/21 (47%) Query: 86 RVFLANHREIYDVTDASSMQS 106 R+FL + R IY + S Sbjct: 46 RIFLTSQRIIYIDDAKPTQNS 66 >d2g9hd1 b.40.2.2 (D:4-86) Enterotoxin type I, SEI {Staphylococcus aureus [TaxId: 1280]} Length = 83 Score = 23.2 bits (50), Expect = 6.8 Identities = 10/36 (27%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Query: 5 LRNQYFDSNNLSGEYISSKDQ---NFLYFPTEKQQL 37 LRN Y + + + + K+ N L F T L Sbjct: 6 LRNFYTKHDYIDLKGLIDKNLPSANQLEFSTGINDL 41 >d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Score = 22.7 bits (48), Expect = 8.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 81 SSTQQRVFLANHREIYDVTDASSMQSA 107 + Q+ FL REI + DA +Q A Sbjct: 20 AQKHQQTFLNQLREITGINDAQILQQA 46 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.130 0.386 Gapped Lambda K H 0.267 0.0658 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 374,111 Number of extensions: 13625 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's gapped: 26 Number of HSP's successfully gapped: 5 Length of query: 114 Length of database: 2,407,596 Length adjustment: 72 Effective length of query: 42 Effective length of database: 1,419,036 Effective search space: 59599512 Effective search space used: 59599512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.0 bits)