BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781136|ref|YP_003065549.1| hypothetical protein CLIBASIA_05190 [Candidatus Liberibacter asiaticus str. psy62] (114 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781136|ref|YP_003065549.1| hypothetical protein CLIBASIA_05190 [Candidatus Liberibacter asiaticus str. psy62] Length = 114 Score = 240 bits (612), Expect = 6e-66, Method: Compositional matrix adjust. Identities = 114/114 (100%), Positives = 114/114 (100%) Query: 1 MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGG 60 MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGG Sbjct: 1 MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGG 60 Query: 61 CRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE 114 CRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE Sbjct: 61 CRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE 114 >gi|254780784|ref|YP_003065197.1| polynucleotide phosphorylase/polyadenylase [Candidatus Liberibacter asiaticus str. psy62] Length = 699 Score = 22.7 bits (47), Expect = 1.7, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 38 QENAFSILHNFWPTTKGPIMRGG 60 Q N F + +NF P G + R G Sbjct: 370 QRNDFMMHYNFLPCATGEVSRMG 392 >gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Score = 21.9 bits (45), Expect = 3.5, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 23 KDQNFLYFPTEKQQLQENAFSI 44 +DQ++ F T +QQL + F + Sbjct: 171 RDQSYFLFATTQQQLCDLRFPL 192 >gi|254780533|ref|YP_003064946.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Score = 21.6 bits (44), Expect = 4.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%) Query: 59 GGCRKICTLDSNSSIISAFSYRSSTQQRVFLANH 92 GG RKI SIIS S S + ++ NH Sbjct: 132 GGPRKISPFTVPGSIISLLSGNISIRNQLRGPNH 165 >gi|254781166|ref|YP_003065579.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 284 Score = 21.2 bits (43), Expect = 5.4, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 13/20 (65%) Query: 9 YFDSNNLSGEYISSKDQNFL 28 + D L+G YI++ +NFL Sbjct: 98 FSDKAELTGPYINTTRENFL 117 >gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 21.2 bits (43), Expect = 5.5, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 11 DSNNLSGEYISSKDQNFL 28 DS+N+SG+ S K N L Sbjct: 119 DSDNISGKPFSGKTGNML 136 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.130 0.386 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,837 Number of Sequences: 1233 Number of extensions: 2462 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 114 length of database: 328,796 effective HSP length: 63 effective length of query: 51 effective length of database: 251,117 effective search space: 12806967 effective search space used: 12806967 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 33 (17.3 bits)