RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781137|ref|YP_003065550.1| hypothetical protein CLIBASIA_05195 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >gnl|CDD|181838 PRK09418, PRK09418, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed. Length = 780 Score = 31.6 bits (71), Expect = 0.13 Identities = 11/25 (44%), Positives = 20/25 (80%) Query: 15 GLSRFETVYQNQDESTVLLVSFLQQ 39 G+S+ E VYQ+QDE+ ++V ++Q+ Sbjct: 569 GVSKGEVVYQSQDETRQIIVKYMQE 593 >gnl|CDD|161934 TIGR00571, dam, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. Length = 266 Score = 29.6 bits (67), Expect = 0.56 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 12/82 (14%) Query: 52 QLLQEIKIDHWPFHLPQD---YYRPLLGGAMVMLDLSLARPVINAVDWGIV---KRISHT 105 LL EIK HLP++ P +GG V +L+ R ++N ++ ++ K I + Sbjct: 13 SLLPEIKK-----HLPKNFNCLVEPFVGGGAVFFNLNPKRYLLNDINEDLINLYKAIKNN 67 Query: 106 PWYWI-DGRMIHLSINSPATFR 126 I D R ++ N+ + Sbjct: 68 VDELILDVRKLYAEENTKEYYY 89 >gnl|CDD|180165 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional. Length = 342 Score = 28.2 bits (64), Expect = 1.5 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Query: 167 RRAQGLSFDDCLR-EFDLAL 185 RRA+GL+ ++CLR E LAL Sbjct: 279 RRARGLTLEECLRRELRLAL 298 >gnl|CDD|178540 PLN02954, PLN02954, phosphoserine phosphatase. Length = 224 Score = 26.2 bits (58), Expect = 5.9 Identities = 8/19 (42%), Positives = 11/19 (57%), Gaps = 1/19 (5%) Query: 160 KDIIWRWRRAQGLSFD-DC 177 KD++ WR A + FD D Sbjct: 3 KDVLELWRSADAVCFDVDS 21 >gnl|CDD|179344 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional. Length = 574 Score = 25.9 bits (57), Expect = 6.7 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 72 RPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYW 109 R LGG +V + +S+ P + + +V I H PW W Sbjct: 277 RLALGGLLVGV-ISVWVPEVWGNGYSVVNTILHAPWTW 313 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.141 0.462 Gapped Lambda K H 0.267 0.0637 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,348,012 Number of extensions: 208589 Number of successful extensions: 451 Number of sequences better than 10.0: 1 Number of HSP's gapped: 450 Number of HSP's successfully gapped: 9 Length of query: 195 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 107 Effective length of database: 4,092,969 Effective search space: 437947683 Effective search space used: 437947683 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (24.8 bits)