RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781137|ref|YP_003065550.1| hypothetical protein CLIBASIA_05195 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >1nog_A Conserved hypothetical protein TA0546; structural genomics, PSI, protein structure initiative, midwest center for structural genomics; 1.55A {Thermoplasma acidophilum} (A:) Length = 177 Score = 28.7 bits (64), Expect = 0.58 Identities = 13/97 (13%), Positives = 35/97 (36%), Gaps = 6/97 (6%) Query: 1 MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEIC-----LKVDWPQLLQ 55 + V ++ + +G + + + + + + L GE++ V + Sbjct: 26 VEVQGTIDELNSFIGYALVLSRWDDIRNDLFRIQNDLFVLGEDVSTGGKGRTVTREMIDY 85 Query: 56 -EIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVI 91 E ++ + + + GG++ L +AR V Sbjct: 86 LEARVKEMKAEIGKIELFVVPGGSVESASLHMARAVS 122 >1woz_A 177AA long conserved hypothetical protein (ST1454); structural genomics, unknown function; 1.94A {Sulfolobus tokodaii str} (A:) Length = 177 Score = 28.3 bits (63), Expect = 0.66 Identities = 13/97 (13%), Positives = 36/97 (37%), Gaps = 6/97 (6%) Query: 1 MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQ----- 55 +N L L+ + +G + + +++ + + L + GE++ + ++ + Sbjct: 25 VNFLGDLDELNSFIGFAISKIPWEDXKKDLERVQVELFEIGEDLSTQSSKKKIDEKYVKW 84 Query: 56 -EIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVI 91 E + + + GG+ L + R V Sbjct: 85 LEERTVEYRKESGPVKLFVIPGGSEEASVLHVTRSVA 121 >2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 111 Score = 28.2 bits (63), Expect = 0.73 Identities = 14/82 (17%), Positives = 27/82 (32%), Gaps = 7/82 (8%) Query: 119 INSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKD-IIWRWRRA--QGLSFD 175 + P +N I + K+A + YL I++ I+ +W + L+ Sbjct: 13 LKPPEQEIEIDRNIIQEEEKQAIPEFFEGRQAKTPERYLKIRNYILDQWEICKPKYLNKT 72 Query: 176 DCLR----EFDLALIAEKILWL 193 D+ I +L Sbjct: 73 SVRPGLKNCGDVNCIGRIHTYL 94 >2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial virulence factor, transferase/DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D* (A:1-56,A:157-278) Length = 178 Score = 28.3 bits (63), Expect = 0.83 Identities = 10/44 (22%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 52 QLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVD 95 LL +I H P + P +G V L+ +R ++ ++ Sbjct: 16 PLLDDI-KRHLPKG--ECLVEPFVGAGSVFLNTDFSRYILADIN 56 >2dpm_A M.dpnii 1, protein (adenine-specific methyltransferase dpnii 1); DNA adenine methyltransferase, methylase; HET: SAM; 1.80A {Streptococcus pneumoniae} (A:1-64,A:169-284) Length = 180 Score = 27.5 bits (61), Expect = 1.1 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 52 QLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPW 107 QLL I + P Y+ P +GG + DL+ VIN + + I + Sbjct: 23 QLLPVI-RELIPKTY-NRYFEPFVGGGALFFDLAPKDAVINDFNNQLE--IKVGDF 74 >2nrt_A Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A (A:1-156) Length = 156 Score = 27.4 bits (61), Expect = 1.5 Identities = 13/64 (20%), Positives = 23/64 (35%), Gaps = 9/64 (14%) Query: 61 HWPFHLPQDYYRPLLGGAM-VMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSI 119 P L D + A+ + ++ PV+ G+ K+ + R IHL Sbjct: 83 PLPNLLFVDGGIGQVNAAIEALKEIGKDCPVV-----GLAKKEET---VVFENREIHLPH 134 Query: 120 NSPA 123 + P Sbjct: 135 DHPV 138 >2hbw_A NLP/P60 protein; YP_323898.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics; HET: UNL; 1.05A {Anabaena variabilis atcc 29413} PDB: 2evr_A 2fg0_A (A:86-235) Length = 150 Score = 25.5 bits (55), Expect = 5.5 Identities = 8/23 (34%), Positives = 11/23 (47%) Query: 94 VDWGIVKRISHTPWYWIDGRMIH 116 V +G + +H Y DG IH Sbjct: 82 VFFGTPVKATHVGLYLGDGCYIH 104 >1g0d_A Protein-glutamine gamma-glutamyltransferase; tissue transglutaminase,acyltransferase; 2.50A {Pagrus major} (A:1-141) Length = 141 Score = 25.2 bits (55), Expect = 6.3 Identities = 13/67 (19%), Positives = 20/67 (29%), Gaps = 8/67 (11%) Query: 63 PFHLPQDYYRPLLGGAMVMLDLSLA-RPVINAVDWGIVKRISHTPW----YWIDGRMIHL 117 PF + L + L L L R + + K I L Sbjct: 39 PFSITLQCSDSLPPKHHLELVLHLGKRDEVVI---KVQKEHGARDKWWFNQQGAQDEILL 95 Query: 118 SINSPAT 124 +++SPA Sbjct: 96 TLHSPAN 102 >1cvr_A Gingipain R, RGPB; caspases, cysteine proteinase, hydrolase; HET: DPN ACL; 2.00A {Porphyromonas gingivalis} (A:82-347) Length = 266 Score = 25.1 bits (54), Expect = 6.9 Identities = 8/108 (7%), Positives = 20/108 (18%), Gaps = 11/108 (10%) Query: 7 LNTVCDLVGLS-----RFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDH 61 + + F E+ + + G + Q Sbjct: 151 NSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQY------WA 204 Query: 62 WPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYW 109 P + L + + +N + + K Sbjct: 205 PPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENML 252 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.141 0.462 Gapped Lambda K H 0.267 0.0614 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,661,694 Number of extensions: 74406 Number of successful extensions: 238 Number of sequences better than 10.0: 1 Number of HSP's gapped: 238 Number of HSP's successfully gapped: 17 Length of query: 195 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 111 Effective length of database: 2,116,429 Effective search space: 234923619 Effective search space used: 234923619 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.1 bits)