RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781137|ref|YP_003065550.1| hypothetical protein CLIBASIA_05195 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 34.1 bits (78), Expect = 0.020 Identities = 21/98 (21%), Positives = 27/98 (27%), Gaps = 45/98 (45%) Query: 63 PFHLPQDYYRPLLGGA--MVMLDL----------SLARPVINAVDWG------------- 97 PFH LL A ++ DL + PV + D G Sbjct: 426 PFH------SHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFD-GSDLRVLSGSISER 478 Query: 98 IVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIID 135 IV I P W + AT I+D Sbjct: 479 IVDCIIRLPVKWE------TTTQFKATH-------ILD 503 Score = 30.3 bits (68), Expect = 0.29 Identities = 10/43 (23%), Positives = 11/43 (25%), Gaps = 15/43 (34%) Query: 22 VYQNQDESTVLLVSFLQQAGEEI---------CLKVDWPQLLQ 55 VY D S L+ I L V W Q Sbjct: 459 VYDTFDGSD------LRVLSGSISERIVDCIIRLPVKWETTTQ 495 Score = 28.0 bits (62), Expect = 1.4 Identities = 22/145 (15%), Positives = 39/145 (26%), Gaps = 63/145 (43%) Query: 19 FETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGA 78 F V + + L+ F Q + + L+++ Y L+G Sbjct: 146 FRAV---GEGNAQLVAIFGGQGNTDDYF-----EELRDL----------YQTYHVLVG-- 185 Query: 79 MVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSK-----NWI 133 DL +K + + L + + F++ W+ Sbjct: 186 ----DL--------------IKFSA--------ETLSELIRTTLDAEKVFTQGLNILEWL 219 Query: 134 IDSNKEAKHHITADDDSTLLPTYLL 158 N T D D YLL Sbjct: 220 --ENPSN----TPDKD------YLL 232 >2g1p_A DNA adenine methylase; DAM methylation, GATC recognition, base flipping, bacterial virulence factor, transferase/DNA complex; HET: DNA SAH; 1.89A {Escherichia coli} PDB: 2ore_D* Length = 278 Score = 29.9 bits (66), Expect = 0.39 Identities = 11/98 (11%), Positives = 30/98 (30%), Gaps = 6/98 (6%) Query: 52 QLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVD---WGIVKRISHTPWY 108 LL +I H P + P +G V L+ +R ++ ++ + + Sbjct: 16 PLLDDI-KRHLPKG--ECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDE 72 Query: 109 WIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITA 146 ++ + Y+ + +++ Sbjct: 73 YVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVL 110 >2dpm_A M.dpnii 1, protein (adenine-specific methyltransferase dpnii 1); DNA adenine methyltransferase, methylase; HET: SAM; 1.80A {Streptococcus pneumoniae} SCOP: c.66.1.28 Length = 284 Score = 29.1 bits (64), Expect = 0.67 Identities = 21/98 (21%), Positives = 35/98 (35%), Gaps = 5/98 (5%) Query: 52 QLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIV---KRISHTPWY 108 QLL I + P Y+ P +GG + DL+ VIN + ++ ++I P Sbjct: 23 QLLPVI-RELIPKTY-NRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQE 80 Query: 109 WIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITA 146 I+ +H NS + + A Sbjct: 81 LIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRA 118 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 27.7 bits (60), Expect = 1.6 Identities = 8/22 (36%), Positives = 11/22 (50%), Gaps = 4/22 (18%) Query: 139 EAKHHITADDDSTLLPTYLLIK 160 +A + ADD + P L IK Sbjct: 26 QASLKLYADDSA---PA-LAIK 43 >2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 111 Score = 27.4 bits (61), Expect = 2.0 Identities = 14/82 (17%), Positives = 26/82 (31%), Gaps = 7/82 (8%) Query: 119 INSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDII---WRWRRAQGLSFD 175 + P +N I + K+A + YL I++ I W + + L+ Sbjct: 13 LKPPEQEIEIDRNIIQEEEKQAIPEFFEGRQAKTPERYLKIRNYILDQWEICKPKYLNKT 72 Query: 176 DCLRE----FDLALIAEKILWL 193 D+ I +L Sbjct: 73 SVRPGLKNCGDVNCIGRIHTYL 94 >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Score = 26.8 bits (58), Expect = 3.6 Identities = 5/49 (10%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Query: 136 SNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLA 184 + I + + + ++++ W +G +F + D+ Sbjct: 1009 AKIMKDSKIEVVEKDYVESFRHELMEVVYEW--CRGATFTQICKMTDVY 1055 >2hbw_A NLP/P60 protein; YP_323898.1, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics; HET: UNL; 1.05A {Anabaena variabilis atcc 29413} PDB: 2evr_A 2fg0_A Length = 235 Score = 26.2 bits (57), Expect = 4.5 Identities = 8/23 (34%), Positives = 11/23 (47%) Query: 96 WGIVKRISHTPWYWIDGRMIHLS 118 +G + +H Y DG IH S Sbjct: 169 FGTPVKATHVGLYLGDGCYIHSS 191 >2jyx_A Lipoprotein SPR; solution structure, construct optimized, membrane, palmitate, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli K12} PDB: 2k1g_A Length = 136 Score = 26.2 bits (57), Expect = 4.8 Identities = 5/25 (20%), Positives = 9/25 (36%) Query: 94 VDWGIVKRISHTPWYWIDGRMIHLS 118 V + H Y + + +H S Sbjct: 74 VLFRAGSTGRHVGIYIGNNQFVHAS 98 >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Score = 25.9 bits (56), Expect = 5.5 Identities = 5/46 (10%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Query: 139 EAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLA 184 I + + + ++++ W +G +F + D+ Sbjct: 914 MKDSKIEVVEKDYVESFRHELMEVVYEW--CRGATFTQICKMTDVY 957 >2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 Length = 104 Score = 25.9 bits (57), Expect = 6.2 Identities = 7/44 (15%), Positives = 16/44 (36%), Gaps = 5/44 (11%) Query: 155 TYLLIKD-IIWRWRR--AQGLSFDDCLREF--DLALIAEKILWL 193 Y+ ++ ++ +R + S R D A + +L Sbjct: 48 VYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFL 91 >3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Length = 246 Score = 26.0 bits (56), Expect = 6.2 Identities = 21/111 (18%), Positives = 37/111 (33%), Gaps = 10/111 (9%) Query: 50 WPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLAR------PVINAVDWGIVKRIS 103 + + + + D RP L ++ ++ A VI A+D IV+ + Sbjct: 93 IRFVEKTYGLTDDDIIVTHDAVRPFLTHRIIEENIDAALETGAVDTVIEALD-TIVESSN 151 Query: 104 HTPWYWIDGRMIHLSINSPATFRYFS-KNWIIDSNKEAKHHITADDDSTLL 153 H I R +P +F N + E K +T D + Sbjct: 152 HEVITDIPVRDHMYQGQTPQSFNMKKVFNHYQNLTPEKKQILT--DACKIC 200 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.325 0.141 0.462 Gapped Lambda K H 0.267 0.0574 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,859,821 Number of extensions: 84558 Number of successful extensions: 268 Number of sequences better than 10.0: 1 Number of HSP's gapped: 267 Number of HSP's successfully gapped: 22 Length of query: 195 Length of database: 5,693,230 Length adjustment: 87 Effective length of query: 108 Effective length of database: 3,584,002 Effective search space: 387072216 Effective search space used: 387072216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (24.9 bits)