BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781137|ref|YP_003065550.1| hypothetical protein CLIBASIA_05195 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781137|ref|YP_003065550.1| hypothetical protein CLIBASIA_05195 [Candidatus Liberibacter asiaticus str. psy62] Length = 195 Score = 401 bits (1030), Expect = e-114, Method: Compositional matrix adjust. Identities = 195/195 (100%), Positives = 195/195 (100%) Query: 1 MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKID 60 MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKID Sbjct: 1 MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKID 60 Query: 61 HWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSIN 120 HWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSIN Sbjct: 61 HWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSIN 120 Query: 121 SPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLRE 180 SPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLRE Sbjct: 121 SPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLRE 180 Query: 181 FDLALIAEKILWLGG 195 FDLALIAEKILWLGG Sbjct: 181 FDLALIAEKILWLGG 195 >gi|254781096|ref|YP_003065509.1| UDP-N-acetylmuramate--L-alanine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Score = 25.4 bits (54), Expect = 0.61, Method: Compositional matrix adjust. Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 7/54 (12%) Query: 18 RFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYY 71 +F + + + D ++L+S + AGE+ P+L++ IK+ PQ YY Sbjct: 377 QFSSCFGDAD---IVLISPVYSAGEKEIPGFSSPELVKNIKLQGH----PQAYY 423 >gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 559 Score = 24.6 bits (52), Expect = 1.3, Method: Compositional matrix adjust. Identities = 12/27 (44%), Positives = 18/27 (66%) Query: 75 LGGAMVMLDLSLARPVINAVDWGIVKR 101 +G +V+L SL R V A+D GI+K+ Sbjct: 250 IGRKIVLLGSSLKRVVSVAIDVGIIKK 276 >gi|254780503|ref|YP_003064916.1| putative glutamine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 22.3 bits (46), Expect = 6.5, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 159 IKDIIWRWRRAQGLSFDDCLRE 180 I D IW++ QGL D + E Sbjct: 194 IIDDIWKFSEKQGLEIDTLIHE 215 >gi|254780900|ref|YP_003065313.1| homoserine dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 21.9 bits (45), Expect = 7.5, Method: Compositional matrix adjust. Identities = 8/10 (80%), Positives = 8/10 (80%) Query: 171 GLSFDDCLRE 180 GLSF DCL E Sbjct: 175 GLSFQDCLEE 184 >gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Score = 21.9 bits (45), Expect = 7.5, Method: Compositional matrix adjust. Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 11/120 (9%) Query: 6 ILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFH 65 +LN + +++ LSR E ES + L+ +++ + L+ + KID Sbjct: 301 LLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEKNIEIFQKIDPSLSS 360 Query: 66 LPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSI--NSPA 123 + D G V+L+L + NAV + + H W GR ++SI N P Sbjct: 361 VWADEK----GMRQVILNL-----LSNAVKFTAIGGRVHVTVGWTSGRGQYISIKDNGPG 411 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.141 0.462 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 131,477 Number of Sequences: 1233 Number of extensions: 5363 Number of successful extensions: 17 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 8 length of query: 195 length of database: 328,796 effective HSP length: 69 effective length of query: 126 effective length of database: 243,719 effective search space: 30708594 effective search space used: 30708594 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 36 (18.5 bits)