Query         gi|254781138|ref|YP_003065551.1| hypothetical protein CLIBASIA_05200 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 178
No_of_seqs    113 out of 799
Neff          7.3 
Searched_HMMs 23785
Date          Wed Jun  1 01:13:43 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781138.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3fyr_A Sporulation inhibitor S  40.0      12 0.00052   16.4   2.0   17   24-40     22-39  (48)
  2 1e7l_A GP49, recombination end  32.3      23 0.00096   14.8   3.7   43    2-45     81-124 (157)
  3 3d55_A Antitoxin, uncharacteri  11.2      57  0.0024   12.6   0.7   18    1-18      1-18  (91)
  4 2kld_A Polycystin-2; PC2, PKD2   8.4      62  0.0026   12.4   0.0   37    4-44     10-46  (123)
  5 2dky_A RHO-GTPase-activating p   6.9      86  0.0036   11.6   0.1   22  143-165    23-44  (91)
  6 3lx3_A 6-pyruvoyl tetrahydrobi   6.2 1.1E+02  0.0048   10.9   2.0   17    1-17     67-83  (180)
  7 1bt3_A Protein (catechol oxida   6.1 1.2E+02  0.0049   10.9   1.6   11  153-163   277-288 (345)
  8 2oba_A Probable 6-pyruvoyl tet   6.0 1.2E+02   0.005   10.8   1.0   18    1-18     68-85  (138)
  9 2g64_A Putative 6-pyruvoyl tet   5.9 1.2E+02   0.005   10.8   2.0   20    1-20     64-83  (140)
 10 2h80_A STAR-related lipid tran   5.4      80  0.0034   11.8  -0.7   21  144-165    22-42  (81)

No 1  
>3fyr_A Sporulation inhibitor SDA; helical hairpin, histidine kinase inhibitor, sporulation regulation, alternative initiation; 1.97A {Bacillus subtilis} PDB: 1pv0_A 3d36_C*
Probab=39.97  E-value=12  Score=16.36  Aligned_cols=17  Identities=29%  Similarity=0.497  Sum_probs=14.1

Q ss_pred             HH-HHHHHHHHHHHHHHC
Q ss_conf             57-799999999996103
Q gi|254781138|r   24 LF-KNFLHRIEVKINRAL   40 (178)
Q Consensus        24 ~I-~~FI~~aE~rI~R~l   40 (178)
                      ++ |+||.+-|.+|.|+-
T Consensus        22 ~L~~dFI~Lie~EI~RRs   39 (48)
T 3fyr_A           22 NLNRDFIELIENEIKRRS   39 (48)
T ss_dssp             TCCHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHH
T ss_conf             479999999999999974


No 2  
>1e7l_A GP49, recombination endonuclease VII; resolvase, holliday junction, DNAse; HET: SO4; 1.32A {Bacteriophage T4} SCOP: a.140.4.1 d.4.1.5 PDB: 2qnc_A* 1en7_A 1e7d_A 2qnf_A*
Probab=32.35  E-value=23  Score=14.84  Aligned_cols=43  Identities=21%  Similarity=0.272  Sum_probs=32.2

Q ss_pred             CCCHHHHHHHHHHHHCCCCCHHHH-HHHHHHHHHHHHHHCCCCCE
Q ss_conf             757899999999874265003457-79999999999610374201
Q gi|254781138|r    2 AKDFASLLIDVSHYVEKGGFTYLF-KNFLHRIEVKINRALRLREM   45 (178)
Q Consensus         2 a~~Y~~L~~~I~~~l~r~dlt~~I-~~FI~~aE~rI~R~lr~~~~   45 (178)
                      +.+|.+..-++++||+.+-.+..| |.|+..=..++.| +.-.+|
T Consensus        81 ~~d~i~~l~n~~~YL~~d~s~n~lHp~~~~d~~K~f~r-l~k~~~  124 (157)
T 1e7l_A           81 GVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSR-LGKEEM  124 (157)
T ss_dssp             TCCHHHHHHHHHHHHHSCCTTSCBCTHHHHHHHHHHHT-SCHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH-CCHHHH
T ss_conf             33199999999999704666776585213889999986-489999


No 3  
>3d55_A Antitoxin, uncharacterized protein RV3357/MT3465; tetramer, toxin neutraliSer, toxin inhibitor; 2.13A {Mycobacterium tuberculosis} PDB: 3cto_A
Probab=11.23  E-value=57  Score=12.60  Aligned_cols=18  Identities=11%  Similarity=0.063  Sum_probs=13.4

Q ss_pred             CCCCHHHHHHHHHHHHCC
Q ss_conf             975789999999987426
Q gi|254781138|r    1 MAKDFASLLIDVSHYVEK   18 (178)
Q Consensus         1 Ma~~Y~~L~~~I~~~l~r   18 (178)
                      |+.+|++.+++...++++
T Consensus         1 ~tvs~seaR~nL~~lid~   18 (91)
T 3d55_A            1 MSISASEARQRLFPLIEQ   18 (91)
T ss_dssp             CEEEHHHHHHTHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHH
T ss_conf             930399999979999999


No 4  
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A
Probab=8.41  E-value=62  Score=12.40  Aligned_cols=37  Identities=14%  Similarity=0.259  Sum_probs=26.1

Q ss_pred             CHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             78999999998742650034577999999999961037420
Q gi|254781138|r    4 DFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLRE   44 (178)
Q Consensus         4 ~Y~~L~~~I~~~l~r~dlt~~I~~FI~~aE~rI~R~lr~~~   44 (178)
                      +|++-|+.++  .-++||  +|-++|...=.++...|+...
T Consensus        10 TYSEVKadla--~qk~ef--el~d~iKkgY~k~l~KLklKK   46 (123)
T 2kld_A           10 TYSEVKSDLA--QQKAEM--ELSDLIRKGYHKALVKLKLKK   46 (123)
T ss_dssp             -----------------------------------------
T ss_pred             CHHHHHHHHH--CCCCCC--HHHHHHHHHHHHHHHHHHHCC
T ss_conf             1899999996--389710--799999999999999986123


No 5  
>2dky_A RHO-GTPase-activating protein 7; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.3 PDB: 2gyt_A 2kap_A
Probab=6.89  E-value=86  Score=11.60  Aligned_cols=22  Identities=14%  Similarity=0.329  Sum_probs=11.9

Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             99999741498889999999999
Q gi|254781138|r  143 VEEIALWEQKIDKATTASALFQE  165 (178)
Q Consensus       143 L~eA~~flk~~~~~~~~~~~y~~  165 (178)
                      -.||+.||+ ....+.|.++|++
T Consensus        23 A~eAC~WLR-aaGFpqYAqlyEd   44 (91)
T 2dky_A           23 AKEACDWLR-ATGFPQYAQLYED   44 (91)
T ss_dssp             HHHHHHHHH-HHTCTTHHHHHHT
T ss_pred             HHHHHHHHH-HCCCHHHHHHHHH
T ss_conf             999999999-8288489998650


No 6  
>3lx3_A 6-pyruvoyl tetrahydrobiopterin synthase; PTS, PTP synthase, PTPS, metal-binding, tetrahydrobiopterin biosynthesis, folate biosynthesis; HET: XTN; 1.55A {Plasmodium vivax} PDB: 2a0s_A* 3m0n_A* 3lze_A*
Probab=6.24  E-value=1.1e+02  Score=10.93  Aligned_cols=17  Identities=24%  Similarity=0.245  Sum_probs=8.2

Q ss_pred             CCCCHHHHHHHHHHHHC
Q ss_conf             97578999999998742
Q gi|254781138|r    1 MAKDFASLLIDVSHYVE   17 (178)
Q Consensus         1 Ma~~Y~~L~~~I~~~l~   17 (178)
                      |..+|+.||..++.+.+
T Consensus        67 mViDF~~lK~~ik~i~d   83 (180)
T 3lx3_A           67 YVIDFSILKEKVRKVCK   83 (180)
T ss_dssp             CSSCHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             00379999999999998


No 7  
>1bt3_A Protein (catechol oxidase); dicopper enzyme, oxidoreductase; 2.50A {Ipomoea batatas} SCOP: a.86.1.2 PDB: 1bt2_A 1bt1_A 1bug_A*
Probab=6.12  E-value=1.2e+02  Score=10.89  Aligned_cols=11  Identities=27%  Similarity=0.298  Sum_probs=5.2

Q ss_pred             HHHH-HHHHHHH
Q ss_conf             8889-9999999
Q gi|254781138|r  153 IDKA-TTASALF  163 (178)
Q Consensus       153 ~~~~-~~~~~~y  163 (178)
                      -+|+ .+|+++.
T Consensus       277 IDRlW~~WQ~~~  288 (345)
T 1bt3_A          277 VDRMWTIWQQLA  288 (345)
T ss_dssp             HHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHC
T ss_conf             999999998626


No 8  
>2oba_A Probable 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, PTP synthase, PTPS, lyase; 2.33A {Pseudomonas aeruginosa}
Probab=5.96  E-value=1.2e+02  Score=10.84  Aligned_cols=18  Identities=22%  Similarity=0.255  Sum_probs=12.2

Q ss_pred             CCCCHHHHHHHHHHHHCC
Q ss_conf             975789999999987426
Q gi|254781138|r    1 MAKDFASLLIDVSHYVEK   18 (178)
Q Consensus         1 Ma~~Y~~L~~~I~~~l~r   18 (178)
                      |..+|++||..++..+++
T Consensus        68 ~viDf~~lk~~~~~i~~~   85 (138)
T 2oba_A           68 WIRDFAEIKAIFKPIYEQ   85 (138)
T ss_dssp             SSSCHHHHHHHHHHHHHH
T ss_pred             EEEEHHHHHHHHHHHHHH
T ss_conf             787199999999986765


No 9  
>2g64_A Putative 6-pyruvoyl tetrahydrobiopterin synthase; tetrahydrobiopterin biosynthesis, phosphate elimination, pterine synthesis; 1.80A {Caenorhabditis elegans} SCOP: d.96.1.2
Probab=5.85  E-value=1.2e+02  Score=10.80  Aligned_cols=20  Identities=25%  Similarity=0.272  Sum_probs=15.2

Q ss_pred             CCCCHHHHHHHHHHHHCCCC
Q ss_conf             97578999999998742650
Q gi|254781138|r    1 MAKDFASLLIDVSHYVEKGG   20 (178)
Q Consensus         1 Ma~~Y~~L~~~I~~~l~r~d   20 (178)
                      |..+|++||..+..+.++=|
T Consensus        64 ~viDf~~lk~~~~~ii~~lD   83 (140)
T 2g64_A           64 MVYDLAKLKKEMSLVLDTVD   83 (140)
T ss_dssp             CSSCHHHHHHHHHHHHHTTT
T ss_pred             EEEEHHHHHHHHHHHHHHHH
T ss_conf             59639999999999998743


No 10 
>2h80_A STAR-related lipid transfer protein 13; helical bundle, lipid binding protein; NMR {Homo sapiens} SCOP: a.60.1.3 PDB: 2jw2_A
Probab=5.44  E-value=80  Score=11.78  Aligned_cols=21  Identities=14%  Similarity=0.338  Sum_probs=10.7

Q ss_pred             HHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             9999741498889999999999
Q gi|254781138|r  144 EEIALWEQKIDKATTASALFQE  165 (178)
Q Consensus       144 ~eA~~flk~~~~~~~~~~~y~~  165 (178)
                      .||+.||+ ...-+.|.++|++
T Consensus        22 ~eAC~WLR-aaGFpqYAqlyEd   42 (81)
T 2h80_A           22 KEACDWLR-AAGFPQYAQLYED   42 (81)
T ss_dssp             HHHHHHHH-HTTCHHHHHTTTT
T ss_pred             HHHHHHHH-HCCCHHHHHHHHC
T ss_conf             99999999-8388489998660


Done!