BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781138|ref|YP_003065551.1| hypothetical protein CLIBASIA_05200 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781138|ref|YP_003065551.1| hypothetical protein CLIBASIA_05200 [Candidatus Liberibacter asiaticus str. psy62] Length = 178 Score = 365 bits (938), Expect = e-103, Method: Compositional matrix adjust. Identities = 178/178 (100%), Positives = 178/178 (100%) Query: 1 MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPL 60 MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPL Sbjct: 1 MAKDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKINRALRLREMERKIVLSLVEGSAPL 60 Query: 61 PDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPP 120 PDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPP Sbjct: 61 PDDYIEIRFLEDNKGNKLDHLPLSISLQKNKGYIITADSICVLPISSEDVVLYYYACIPP 120 Query: 121 LTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW 178 LTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW Sbjct: 121 LTENNPVNWLLHRAPDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQQNDIRSW 178 >gi|254780214|ref|YP_003064627.1| metal-dependent hydrolase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 23.1 bits (48), Expect = 3.1, Method: Compositional matrix adjust. Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 7/63 (11%) Query: 119 PPLTENNPVNWLLHRA-------PDLYLYGLVEEIALWEQKIDKATTASALFQESIKKLQ 171 P + ENN V + A P L +G + + + T +A ES++KLQ Sbjct: 140 PIVIENNDVPICMKSAGGVIEAIPILQQHGRISSLGFRFGNVAYCTDVNAFPAESLEKLQ 199 Query: 172 QND 174 D Sbjct: 200 NLD 202 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 23.1 bits (48), Expect = 3.2, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 35 KINRALRLREMERKIVLSLV 54 K+ RALRL E+ ++ V SLV Sbjct: 310 KLKRALRLEEINKESVESLV 329 >gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str. psy62] Length = 781 Score = 21.9 bits (45), Expect = 6.9, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Query: 3 KDFASLLIDVSHYVEKGGFTYLFKNFLHRIEVKIN 37 +DFA ++D+ + +++G Y + RIE++ N Sbjct: 346 RDFAKRIVDIEYLIDQGSPLY-----VKRIEIEGN 375 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.139 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 121,861 Number of Sequences: 1233 Number of extensions: 5088 Number of successful extensions: 13 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 8 length of query: 178 length of database: 328,796 effective HSP length: 68 effective length of query: 110 effective length of database: 244,952 effective search space: 26944720 effective search space used: 26944720 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 35 (18.1 bits)