BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781139|ref|YP_003065552.1| hypothetical protein CLIBASIA_05205 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781139|ref|YP_003065552.1| hypothetical protein CLIBASIA_05205 [Candidatus Liberibacter asiaticus str. psy62] Length = 65 Score = 136 bits (342), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 65/65 (100%), Positives = 65/65 (100%) Query: 1 MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRT 60 MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRT Sbjct: 1 MEINQACAMATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVWVNKWLNNRDNASWRT 60 Query: 61 SEGYV 65 SEGYV Sbjct: 61 SEGYV 65 >gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Score = 23.5 bits (49), Expect = 0.69, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 20 RIASIPVSILKDSHLLQAHTEGDDVWVNKWL 50 R +SIP+ + DS + + E +V + WL Sbjct: 524 RKSSIPIDKISDSQVQEHAIENSNVILQLWL 554 >gi|254781170|ref|YP_003065583.1| deoxyribodipyrimidine photolyase [Candidatus Liberibacter asiaticus str. psy62] Length = 483 Score = 21.6 bits (44), Expect = 2.9, Method: Composition-based stats. Identities = 9/12 (75%), Positives = 10/12 (83%) Query: 30 KDSHLLQAHTEG 41 KDSHLLQA +G Sbjct: 318 KDSHLLQAWKQG 329 >gi|254780283|ref|YP_003064696.1| thioredoxin reductase (NADPH) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Score = 20.4 bits (41), Expect = 6.5, Method: Composition-based stats. Identities = 10/37 (27%), Positives = 17/37 (45%) Query: 9 MATRKKNRDWQRIASIPVSILKDSHLLQAHTEGDDVW 45 M + +N + I + VS+ D H T+ D+W Sbjct: 68 MRQQAENFGTKIIQDLVVSVDLDRHPFLVETQSGDLW 104 >gi|254780523|ref|YP_003064936.1| flagellar hook-associated protein FlgL [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Score = 20.0 bits (40), Expect = 7.2, Method: Composition-based stats. Identities = 6/14 (42%), Positives = 8/14 (57%) Query: 42 DDVWVNKWLNNRDN 55 D+ W N W N D+ Sbjct: 207 DEYWANNWSNASDH 220 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.127 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,169 Number of Sequences: 1233 Number of extensions: 1357 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 65 length of database: 328,796 effective HSP length: 36 effective length of query: 29 effective length of database: 284,408 effective search space: 8247832 effective search space used: 8247832 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)