RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781140|ref|YP_003065553.1| hypothetical protein CLIBASIA_05210 [Candidatus Liberibacter asiaticus str. psy62] (44 letters) >gnl|CDD|184111 PRK13524, PRK13524, outer membrane receptor FepA; Provisional. Length = 744 Score = 27.7 bits (62), Expect = 0.73 Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 23 YMLDNQKRCVSDRLSCIPSY 42 YML ++ + D LS IP Y Sbjct: 611 YMLQSKNKTTGDPLSIIPEY 630 >gnl|CDD|184940 PRK14977, PRK14977, bifunctional DNA-directed RNA polymerase A'/A'' subunit; Provisional. Length = 1321 Score = 27.7 bits (61), Expect = 0.75 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 3 IYDGSWKLISYDPETGRTVWYML 25 I D +LI +DP+ R W +L Sbjct: 198 IIDDDLELIGFDPKKARPEWAVL 220 >gnl|CDD|163208 TIGR03300, assembly_YfgL, outer membrane assembly lipoprotein YfgL. Members of this protein family are YfgL, a lipoprotein component of a complex that acts protein insertion into the bacterial outer membrane. Other members of this complex are NlpB, YfiO, and YaeT. This protein contains multiple copies of a repeat that, in other contexts, are associated with binding of the coenzyme PQQ. Length = 377 Score = 25.3 bits (56), Expect = 4.0 Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 6/33 (18%) Query: 5 DGSWKLISYDPETGRTVWYMLDNQKRCVSDRLS 37 D +++ D ETG+ +W + + +RLS Sbjct: 72 DADGTVVALDAETGKRLW------RVDLDERLS 98 >gnl|CDD|149339 pfam08223, PaaX_C, PaaX-like protein C-terminal domain. This family contains proteins that are similar to the product of the paaX gene of Escherichia coli. This protein is involved in the regulation of expression of a group of proteins known to participate in the metabolism of phenylacetic acid. Length = 170 Score = 24.9 bits (55), Expect = 5.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 5 DGSWKLISYDPETGRTVW 22 DGSW L+ PE+ R Sbjct: 5 DGSWHLVVLSPESDRAAR 22 >gnl|CDD|162204 TIGR01107, Na_K_ATPase_bet, Sodium Potassium ATPase beta subunit. This model describes the Na+/K+ ATPase beta subunit in eukaryotes. Na+/K+ ATPase(also called Sodium-Potassium pump) is intimately associated with the plasma membrane. It couples the energy released by the hydrolysis of ATP to extrude 3 Na+ ions, with the concomitant uptake of 2K+ ions, against their ionic gradients. Length = 289 Score = 24.2 bits (53), Expect = 8.2 Identities = 9/20 (45%), Positives = 11/20 (55%), Gaps = 4/20 (20%) Query: 5 DGSWKLISYDPET----GRT 20 G WK ++PET GRT Sbjct: 13 MGEWKKFIWNPETKEFLGRT 32 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.139 0.473 Gapped Lambda K H 0.267 0.0590 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 739,520 Number of extensions: 26078 Number of successful extensions: 90 Number of sequences better than 10.0: 1 Number of HSP's gapped: 90 Number of HSP's successfully gapped: 12 Length of query: 44 Length of database: 5,994,473 Length adjustment: 17 Effective length of query: 27 Effective length of database: 5,627,137 Effective search space: 151932699 Effective search space used: 151932699 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)