BLAST/PSIBLAST alignment of GI: 254781141 and GI: 241760936 at iteration 2
>gi|241760936|ref|ZP_04759025.1| hypothetical protein ZmobDRAFT_0101 [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 283
>gi|260753096|ref|YP_003225989.1| hypothetical protein Za10_0859 [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 283
>gi|241374555|gb|EER64016.1| hypothetical protein ZmobDRAFT_0101 [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 283
>gi|258552459|gb|ACV75405.1| hypothetical protein Za10_0859 [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 283
 Score = 49.8 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/190 (15%), Positives = 64/190 (33%), Gaps = 11/190 (5%)

Query: 10  QSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNIAKE 69
             A+ LA+      P    P L  + P +Y       +      +  V+         + 
Sbjct: 87  HYADQLAKYAEAITPKKPDPQLLVSDPASYAAQLASYEDLTAKRDQIVQEVIQISRQNEM 146

Query: 70  LDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHRLL 129
            +          E+Q+L  L P+  D  QR          G  LG+    + +   + ++
Sbjct: 147 AELAARRAWAQGEHQRLISLLPEWGDDNQRPAILAAFEETGRHLGYPDHVLAEADSNDIM 206

Query: 130 SLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHR---------RITSQEKAIQK 180
           +L    +   +S+K   DA  + +     +  T++              +     +++ +
Sbjct: 207 ALKKAHEWRRKSEKW--DALQQGKAAAIKSAKTSRKTAVPGTSQPYGAAKSRKLNESLGQ 264

Query: 181 LYQTGSLYDS 190
           L +TG +  +
Sbjct: 265 LRETGDVRSA 274