RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781141|ref|YP_003065554.1| hypothetical protein CLIBASIA_05225 [Candidatus Liberibacter asiaticus str. psy62] (196 letters) >gnl|CDD|37885 KOG2674, KOG2674, KOG2674, Cysteine protease required for autophagy - Apg4p/Aut2p [Cytoskeleton, Intracellular trafficking, secretion, and vesicular transport]. Length = 409 Score = 28.0 bits (62), Expect = 1.9 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 15 LAQ-LINHHIPDDSSPTLEKTYPETYHRI 42 LAQ LI H+ D T EK E Y +I Sbjct: 107 LAQALICRHLGRDWRWTDEKRLEEEYLKI 135 >gnl|CDD|33400 COG3600, GepA, Uncharacterized phage-associated protein [Function unknown]. Length = 154 Score = 26.8 bits (59), Expect = 4.0 Identities = 17/86 (19%), Positives = 32/86 (37%), Gaps = 4/86 (4%) Query: 107 FRIGN-ILGFQKEEMVDITDHRLLSLAYYAQ---IGLQSQKLSEDAYHKIRHKPFVNITT 162 I N L E + +T +L L YYA + + + L ++ +H P + Sbjct: 8 RAIANWFLDKADELDIPVTPLKLQKLLYYAHGWFLAVTGRPLFDEKIEAWKHGPVIPSLY 67 Query: 163 NKAKNHRRITSQEKAIQKLYQTGSLY 188 N K + + E+ + G+ Sbjct: 68 NAFKQYGSNSIDERLPVRGLSNGNAL 93 >gnl|CDD|146520 pfam03934, GspK, General secretion pathway protein K. Members of this family are involved in the general secretion pathway. The family includes proteins such as ExeK, PulK, OutX and XcpX. Length = 282 Score = 26.9 bits (60), Expect = 4.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 2 QNQAKILAQSAEALAQLI 19 + QA A AEALA+ I Sbjct: 15 RQQAYWYALGAEALARQI 32 >gnl|CDD|133341 cd04141, Rit_Rin_Ric, Rit/Rin/Ric subfamily. Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics. These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains. Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42. Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells. Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42. This ternary complex is proposed to have physiological function in processes such as tumorigenesis. Activated Ric is likely to signal in parallel with the Ras pathway or stimulate the Ras pathway at some upstream point, and binding of calmodulin to Ric may negatively regulate Ric activity. Length = 172 Score = 26.3 bits (58), Expect = 5.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Query: 17 QLINHHIPDDSSPTLEKTY 35 Q I+H PD PT+E Y Sbjct: 21 QFISHSFPDYHDPTIEDAY 39 >gnl|CDD|146096 pfam03289, Pox_I1, Poxvirus protein I1. Length = 312 Score = 26.2 bits (58), Expect = 5.7 Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Query: 108 RIGNILGFQKEEMVDI--TDHRLLSLAYYAQIGLQSQKLSEDAYHKIRH 154 +I +ILG + ++ T H +L + + + S+K ED Y +I Sbjct: 235 KIADILGIETVKIGSFIYTKHSMLVSSISSNVDRYSKKFQEDFYERIAE 283 >gnl|CDD|37686 KOG2475, KOG2475, KOG2475, CDC45 (cell division cycle 45)-like protein [Replication, recombination and repair]. Length = 587 Score = 26.4 bits (58), Expect = 5.8 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 13/77 (16%) Query: 128 LLSLAYYAQIGLQSQ----KLSEDAY---------HKIRHKPFVNITTNKAKNHRRITSQ 174 L + A +GL SQ K++E Y H R P N + RIT + Sbjct: 228 NNDLLWLAIVGLTSQMIHKKITEMYYQRCVDLLQDHVNRLTPKNIDNQNTLDDCLRITFE 287 Query: 175 EKAIQKLYQTGSLYDSL 191 + LY+ SL+DS+ Sbjct: 288 RELRLMLYRHWSLFDSM 304 >gnl|CDD|36892 KOG1679, KOG1679, KOG1679, Enoyl-CoA hydratase [Lipid transport and metabolism]. Length = 291 Score = 25.7 bits (56), Expect = 9.0 Identities = 17/57 (29%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Query: 28 SPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDNI---AKELDSEILEKKLIA 81 L K T + L ++NH VE D A EL EIL + IA Sbjct: 181 GVALAKELIFTARVLNGAEAAKLGLVNHVVEQNEEGDAAYQKALELAREILPQGPIA 237 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0774 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,305,742 Number of extensions: 117474 Number of successful extensions: 315 Number of sequences better than 10.0: 1 Number of HSP's gapped: 315 Number of HSP's successfully gapped: 16 Length of query: 196 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 107 Effective length of database: 4,340,536 Effective search space: 464437352 Effective search space used: 464437352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (24.9 bits)