RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781141|ref|YP_003065554.1| hypothetical protein
CLIBASIA_05225 [Candidatus Liberibacter asiaticus str. psy62]
         (196 letters)



>d1smyd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus
           thermophilus [TaxId: 274]}
          Length = 1504

 Score = 25.5 bits (55), Expect = 3.4
 Identities = 12/54 (22%), Positives = 23/54 (42%)

Query: 12  AEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETGRNPDN 65
           AEA+ QL+     +     L +         R   +K L ++  F+++G  P+ 
Sbjct: 457 AEAIQQLLKELDLEALEKELLEEMKHPSRARRAKARKRLEVVRAFLDSGNRPEW 510


>d1gkma_ a.127.1.2 (A:) Histidine ammonia-lyase (HAL) {Pseudomonas
           putida [TaxId: 303]}
          Length = 509

 Score = 25.3 bits (55), Expect = 3.7
 Identities = 8/45 (17%), Positives = 15/45 (33%)

Query: 1   MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYL 45
            +N   +LA       Q ++      +S  LEK        + + 
Sbjct: 431 AENTRGVLAIEWLGACQGLDLRKGLKTSAKLEKARQALRSEVAHY 475


>d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type
           protein CysB {Klebsiella aerogenes [TaxId: 28451]}
          Length = 237

 Score = 24.5 bits (52), Expect = 5.8
 Identities = 11/59 (18%), Positives = 23/59 (38%), Gaps = 11/59 (18%)

Query: 39  YHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEILEKKL-IAENQQLEHLFPQTKDP 96
           + R  +LR    + I  F             L  ++++  + +  N+ +E +F   K P
Sbjct: 187 FRRSTFLRSYMYDFIQRFAP----------HLTRDVVDTAVALRSNEDIEAMFKDIKLP 235


>d1j5sa_ c.1.9.8 (A:) Uronate isomerase TM0064 {Thermotoga maritima
           [TaxId: 2336]}
          Length = 451

 Score = 24.5 bits (53), Expect = 6.6
 Identities = 10/41 (24%), Positives = 16/41 (39%)

Query: 35  YPETYHRIRYLRQKALNIINHFVETGRNPDNIAKELDSEIL 75
                 R    R+   N++   VE G+ P   A+EL   + 
Sbjct: 402 LLSFGSRTEMFRRVLSNVVGEMVEKGQIPIKEARELVKHVS 442


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.317    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0608    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 713,825
Number of extensions: 32429
Number of successful extensions: 106
Number of sequences better than 10.0: 1
Number of HSP's gapped: 106
Number of HSP's successfully gapped: 20
Length of query: 196
Length of database: 2,407,596
Length adjustment: 81
Effective length of query: 115
Effective length of database: 1,295,466
Effective search space: 148978590
Effective search space used: 148978590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.3 bits)