BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781141|ref|YP_003065554.1| hypothetical protein
CLIBASIA_05225 [Candidatus Liberibacter asiaticus str. psy62]
         (196 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781141|ref|YP_003065554.1| hypothetical protein CLIBASIA_05225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 196

 Score =  401 bits (1031), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/196 (100%), Positives = 196/196 (100%)

Query: 1   MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETG 60
           MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETG
Sbjct: 1   MQNQAKILAQSAEALAQLINHHIPDDSSPTLEKTYPETYHRIRYLRQKALNIINHFVETG 60

Query: 61  RNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEM 120
           RNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEM
Sbjct: 61  RNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEM 120

Query: 121 VDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQK 180
           VDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQK
Sbjct: 121 VDITDHRLLSLAYYAQIGLQSQKLSEDAYHKIRHKPFVNITTNKAKNHRRITSQEKAIQK 180

Query: 181 LYQTGSLYDSLEIDFV 196
           LYQTGSLYDSLEIDFV
Sbjct: 181 LYQTGSLYDSLEIDFV 196


>gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 442

 Score = 23.9 bits (50), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 10/69 (14%)

Query: 68  KELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRIGNILGFQKEEMVDITDHR 127
           K   S++L+K  IA    + H+  +T   A  EN       +  +LG+  EE+  I    
Sbjct: 19  KSSSSKVLQK--IAGKPMISHVM-ETIAAAGIEN-------VALVLGYGAEEITRINFPP 68

Query: 128 LLSLAYYAQ 136
            LS+ YY Q
Sbjct: 69  TLSVEYYIQ 77


>gi|254780396|ref|YP_003064809.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 317

 Score = 23.1 bits (48), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 7/78 (8%)

Query: 51  NIINHF-VETGRNPDNIAKELDSEILEKKLIAENQQLEHLFPQTKDPAQRENFFKNLFRI 109
           N +N+F V+  RN    A++  S  L+K+ I +N   ++L  Q+  P   +N F  + + 
Sbjct: 100 NTVNYFFVQHARNTGLSAEDF-SSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF--MLKY 156

Query: 110 GNI---LGFQKEEMVDIT 124
           GN+   +   K++M +IT
Sbjct: 157 GNLEMEIPANKQKMKNIT 174


>gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62]
          Length = 227

 Score = 22.3 bits (46), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 9/33 (27%), Positives = 18/33 (54%), Gaps = 6/33 (18%)

Query: 30 TLEKTYPETYHRIRYLRQKALNII------NHF 56
          ++  +Y E+Y R+ +L  + L ++      NHF
Sbjct: 31 SISHSYQESYERLEFLGDRILGLLISTLLFNHF 63


>gi|254780384|ref|YP_003064797.1| serralysin [Candidatus Liberibacter asiaticus str. psy62]
          Length = 665

 Score = 21.9 bits (45), Expect = 7.3,   Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 11/16 (68%)

Query: 49  ALNIINHFVETGRNPD 64
           A + I H V+ GRNPD
Sbjct: 423 ARHYITHGVKEGRNPD 438



 Score = 21.9 bits (45), Expect = 7.3,   Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 11/16 (68%)

Query: 49  ALNIINHFVETGRNPD 64
           A + I H V+ GRNPD
Sbjct: 507 ARHYITHGVKEGRNPD 522


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.317    0.133    0.369 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 123,762
Number of Sequences: 1233
Number of extensions: 4917
Number of successful extensions: 24
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 17
Number of HSP's gapped (non-prelim): 10
length of query: 196
length of database: 328,796
effective HSP length: 69
effective length of query: 127
effective length of database: 243,719
effective search space: 30952313
effective search space used: 30952313
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 36 (18.5 bits)