Query gi|254781142|ref|YP_003065555.1| hypothetical protein CLIBASIA_05230 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 82 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 05:28:10 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781142.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG1961 PinR Site-specific rec 37.7 28 0.00072 16.6 2.5 22 5-26 118-139 (222) 2 COG2768 Uncharacterized Fe-S c 36.5 20 0.00052 17.4 1.6 73 6-81 4-91 (354) 3 TIGR00137 gid gid protein; Int 34.8 24 0.0006 17.0 1.7 21 18-38 69-89 (444) 4 pfam01054 MMTV_SAg Mouse mamma 27.9 27 0.00069 16.7 1.1 28 16-43 130-157 (314) 5 PRK13413 mpi multiple promoter 25.5 60 0.0015 14.9 2.5 20 5-24 116-135 (200) 6 TIGR00491 aIF-2 translation in 18.4 51 0.0013 15.3 0.9 25 15-39 904-930 (1145) 7 KOG1962 consensus 16.6 95 0.0024 13.9 2.6 41 7-47 58-101 (216) 8 KOG3768 consensus 15.7 80 0.002 14.3 1.4 57 15-71 62-118 (888) 9 COG1747 Uncharacterized N-term 14.1 1.1E+02 0.0028 13.5 2.1 28 17-44 622-657 (711) 10 pfam09043 Lys-AminoMut_A D-Lys 10.5 1.1E+02 0.0028 13.6 0.8 16 50-65 261-276 (509) No 1 >COG1961 PinR Site-specific recombinases, DNA invertase Pin homologs [DNA replication, recombination, and repair] Probab=37.72 E-value=28 Score=16.59 Aligned_cols=22 Identities=27% Similarity=0.440 Sum_probs=18.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHH Q ss_conf 1137799999987687789999 Q gi|254781142|r 5 ESSFADMERHIINRRQSLGSLL 26 (82) Q Consensus 5 essfadmerhiinrrqslgsll 26 (82) .++||.+||+.|..|+..|-.. T Consensus 118 ~~~~Ae~Er~~i~er~~~g~~~ 139 (222) T COG1961 118 LAALAEFERELISERTRAGIEA 139 (222) T ss_pred HHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999889999999999 No 2 >COG2768 Uncharacterized Fe-S center protein [General function prediction only] Probab=36.47 E-value=20 Score=17.36 Aligned_cols=73 Identities=29% Similarity=0.434 Sum_probs=50.2 Q ss_pred HHHHHHHH--HHHHHHHHHHHHHHHH------HHCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCC--CC-----C Q ss_conf 13779999--9987687789999999------86277631430125414579999999999999997257--76-----5 Q gi|254781142|r 6 SSFADMER--HIINRRQSLGSLLITV------LKNARVPIKILMGQRNQLTMIKFLFLHMIRTLIDQVGM--GK-----N 70 (82) Q Consensus 6 ssfadmer--hiinrrqslgsllitv------lknarvpikilmgqrnqltmikflflhmirtlidqvgm--gk-----n 70 (82) --|+||.+ |--|--++|.-|+-++ -++.-+++|+-.|.|...+.|.-.| +|+.+|++-- || . T Consensus 4 Vyft~mra~~p~~n~l~kl~kLf~~ag~~e~vs~dd~vaVKvHfGE~Gn~~fIspv~---~r~IVdkvkeagGkPfvtdT 80 (354) T COG2768 4 VYFTDMRAYSPDENLLSKLEKLFDEAGCVELVSKDDFVAVKVHFGERGNDDFISPVF---VRAIVDKVKEAGGKPFVTDT 80 (354) T ss_pred EEEEHHHCCCCCHHHHHHHHHHHHHHHHHEEECCCCEEEEEEECCCCCCCCEECHHH---HHHHHHHHHHCCCCCEEEEC T ss_conf 453110024954799999999998763521102675576676316777666005688---89998999864898459863 Q ss_pred CHHHHHCCCCC Q ss_conf 01443100135 Q gi|254781142|r 71 RRIYKKNRSNI 81 (82) Q Consensus 71 rriykknrsni 81 (82) .-+|+-.|+|+ T Consensus 81 n~Ly~G~R~na 91 (354) T COG2768 81 NTLYEGSRHNA 91 (354) T ss_pred CCCCCCCHHHH T ss_conf 54024412348 No 3 >TIGR00137 gid gid protein; InterPro: IPR004417 The gid proteins are present in relatively few bacteria but very tightly conserved where they occur. The function of these proteins is unknown. They are closely related to gidA (glucose-inhibited division protein A), which appears to be present in all complete eubacterial genomes so far and in Saccharomyces cerevisiae.. Probab=34.79 E-value=24 Score=17.00 Aligned_cols=21 Identities=33% Similarity=0.453 Sum_probs=18.0 Q ss_pred HHHHHHHHHHHHHHCCCCCHH Q ss_conf 687789999999862776314 Q gi|254781142|r 18 RRQSLGSLLITVLKNARVPIK 38 (82) Q Consensus 18 rrqslgsllitvlknarvpik 38 (82) --|.|+|+.|+.-+.++||-- T Consensus 69 Emr~L~SliI~aAd~~~VPAG 89 (444) T TIGR00137 69 EMRKLDSLIIEAADEAAVPAG 89 (444) T ss_pred HHHHHHHHHHHHHHHCCCCCC T ss_conf 988630799987653368988 No 4 >pfam01054 MMTV_SAg Mouse mammary tumour virus superantigen. The mouse mammary tumour virus (MMTV) is a milk-transmitted type B retrovirus. The superantigen (SAg) is encoded by the long terminal repeat. The SAgs are also called PR73. Probab=27.93 E-value=27 Score=16.70 Aligned_cols=28 Identities=36% Similarity=0.694 Sum_probs=21.0 Q ss_pred HHHHHHHHHHHHHHHHCCCCCHHHHCCC Q ss_conf 8768778999999986277631430125 Q gi|254781142|r 16 INRRQSLGSLLITVLKNARVPIKILMGQ 43 (82) Q Consensus 16 inrrqslgsllitvlknarvpikilmgq 43 (82) .|.....|.||||.|.|...|......| T Consensus 130 tnktnpigrllitmlrnesl~fstiftq 157 (314) T pfam01054 130 TNKTNPIGRLLITMLRNESLPFSTIFTQ 157 (314) T ss_pred CCCCCCHHHHHHHHHHCCCCCHHHHHHH T ss_conf 2688818999999985367665899999 No 5 >PRK13413 mpi multiple promoter invertase; Provisional Probab=25.47 E-value=60 Score=14.92 Aligned_cols=20 Identities=25% Similarity=0.307 Sum_probs=16.5 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 11377999999876877899 Q gi|254781142|r 5 ESSFADMERHIINRRQSLGS 24 (82) Q Consensus 5 essfadmerhiinrrqslgs 24 (82) -+.||+|||..|..|+.-|- T Consensus 116 l~~~Ae~Er~~i~eRt~~g~ 135 (200) T PRK13413 116 FGLSAEIERNLISQRTKEAL 135 (200) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999 No 6 >TIGR00491 aIF-2 translation initiation factor aIF-2; InterPro: IPR004544 Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Some members of this family undergo protein self splicing that involves a post-translational excision of the intein followed by peptide ligation.; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular. Probab=18.36 E-value=51 Score=15.27 Aligned_cols=25 Identities=40% Similarity=0.715 Sum_probs=17.1 Q ss_pred HHHHHHHHHHH--HHHHHHCCCCCHHH Q ss_conf 98768778999--99998627763143 Q gi|254781142|r 15 IINRRQSLGSL--LITVLKNARVPIKI 39 (82) Q Consensus 15 iinrrqslgsl--litvlknarvpiki 39 (82) |+-.-.||||| ++.-|..+-||||. T Consensus 904 vvvKADtLGSLEA~v~~Lr~~~vpIk~ 930 (1145) T TIGR00491 904 VVVKADTLGSLEALVNELRKEGVPIKK 930 (1145) T ss_pred EEEEECCCHHHHHHHHHHHHCCCCEEE T ss_conf 799855851189999999857896766 No 7 >KOG1962 consensus Probab=16.61 E-value=95 Score=13.88 Aligned_cols=41 Identities=24% Similarity=0.244 Sum_probs=26.4 Q ss_pred HHHHHHHHHHHHHHHHHHHH---HHHHHCCCCCHHHHCCCCCHH Q ss_conf 37799999987687789999---999862776314301254145 Q gi|254781142|r 7 SFADMERHIINRRQSLGSLL---ITVLKNARVPIKILMGQRNQL 47 (82) Q Consensus 7 sfadmerhiinrrqslgsll---itvlknarvpikilmgqrnql 47 (82) +|.|--|.|-++..-.|+-. .++.--...--+.+++|||+. T Consensus 58 lfiDsvr~i~~~~~~~~~~~n~~~~~~a~~~~~~~l~raqrn~Y 101 (216) T KOG1962 58 LFIDSVRRIQKYVSEYGSMANPTDQPLARTHLLEALFRAQRNLY 101 (216) T ss_pred HHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999644640014876555677789999988775357 No 8 >KOG3768 consensus Probab=15.74 E-value=80 Score=14.27 Aligned_cols=57 Identities=21% Similarity=0.260 Sum_probs=39.3 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCC Q ss_conf 987687789999999862776314301254145799999999999999972577650 Q gi|254781142|r 15 IINRRQSLGSLLITVLKNARVPIKILMGQRNQLTMIKFLFLHMIRTLIDQVGMGKNR 71 (82) Q Consensus 15 iinrrqslgsllitvlknarvpikilmgqrnqltmikflflhmirtlidqvgmgknr 71 (82) +--.-..+|...|.-+||-..|.+--.+|...+.-.+.|-|.-..|-||.+|.|.+- T Consensus 62 vk~~~~~~~a~~~~eik~l~a~~~s~~~~~~~t~AFdlLnlnR~qtGID~yGqGR~p 118 (888) T KOG3768 62 VKVACEKLGAVVIEEIKKLHAPYGSCQLHHAITEAFDLLNLNRVQTGIDGYGQGRLP 118 (888) T ss_pred HHHHHHHCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC T ss_conf 556776503079888776157631245567888776543155553055455556574 No 9 >COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Probab=14.07 E-value=1.1e+02 Score=13.52 Aligned_cols=28 Identities=46% Similarity=0.602 Sum_probs=22.5 Q ss_pred HHHHHHHHHHHHHHHCCCCCHH--------HHCCCC Q ss_conf 7687789999999862776314--------301254 Q gi|254781142|r 17 NRRQSLGSLLITVLKNARVPIK--------ILMGQR 44 (82) Q Consensus 17 nrrqslgsllitvlknarvpik--------ilmgqr 44 (82) --|++|||.+-..-+||.+|-| .|.||| T Consensus 622 ~vR~~l~Sal~~m~qnas~ssk~lgk~l~~lLVgq~ 657 (711) T COG1747 622 TVRMSLGSALCAMPQNASTSSKRLGKKLWTLLVGQR 657 (711) T ss_pred HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCC T ss_conf 999999989985021268626789999999995253 No 10 >pfam09043 Lys-AminoMut_A D-Lysine 5,6-aminomutase alpha subunit. Members of his family are involved in the 1,2 rearrangement of the terminal amino group of DL-lysine and of L-beta-lysine, using adenosylcobalamin (AdoCbl) and pyridoxal-5'-phosphate as cofactors. The structure is predominantly a PLP-binding TIM barrel domain, with several additional alpha-helices and beta-strands at the N and C termini. These helices and strands form an intertwined accessory clamp structure that wraps around the sides of the TIM barrel and extends up toward the Ado ligand of the Cbl cofactor, providing most of the interactions observed between the protein and the Ado ligand of the Cbl, suggesting that its role is mainly in stabilising AdoCbl in the precatalytic resting state. Probab=10.54 E-value=1.1e+02 Score=13.55 Aligned_cols=16 Identities=50% Similarity=0.629 Sum_probs=10.1 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999999999972 Q gi|254781142|r 50 IKFLFLHMIRTLIDQV 65 (82) Q Consensus 50 ikflflhmirtlidqv 65 (82) |-|--..|.||++||- T Consensus 261 ILFRDINm~RT~vDQ~ 276 (509) T pfam09043 261 ILFRDINMKRTLVDQF 276 (509) T ss_pred HHHCCCCHHHHHHHHH T ss_conf 4440342567688999 Done!