RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] (76 letters) >gnl|CDD|115050 pfam06368, Met_asp_mut_E, Methylaspartate mutase E chain (MutE). This family consists of several methylaspartate mutase E chain proteins (EC:5.4.99.1). Glutamate mutase catalyses the first step in the fermentation of glutamate by Clostridium tetanomorphum. This is an unusual isomerisation in which L-glutamate is converted to threo-beta-methyl L-aspartate. Length = 441 Score = 29.4 bits (66), Expect = 0.19 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 22/91 (24%) Query: 5 VNIGLGS-GNREKDIMMVSHLLALQKEILATFGLNNPFVSTT-HLYNG------------ 50 + +G G GN +DI + L L KE L +G N+ V+T H + G Sbjct: 207 ITVGYGQVGNLTQDIAALRALRELAKEYLGAYGFNDVDVTTVFHQWMGGFPRDESKAYGL 266 Query: 51 ------IARLAEA--VGVQNVNEYFNNPDSE 73 IA L+ V V+ +E P +E Sbjct: 267 ISESTTIAALSGTTKVIVKTPHEASGIPTAE 297 >gnl|CDD|130567 TIGR01503, MthylAspMut_E, methylaspartate mutase, E subunit. This model represents the E (epsilon) subunit of methylaspartate mutase (glutamate mutase), a cobalamin-dependent enzyme that catalyzes the first step in a pathway of glutamate fermentation. Length = 480 Score = 27.5 bits (61), Expect = 0.86 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 22/91 (24%) Query: 5 VNIGLGS-GNREKDIMMVSHLLALQKEILATFGLNNPFVSTT-HLYNG------------ 50 + +G G GN +DI + L E L +G N+ FV+T H + G Sbjct: 246 ITVGYGQVGNLTQDIAALRALEEQTNEYLKAYGYNDVFVTTVFHQWMGGFPEDESKAFGV 305 Query: 51 ------IARLAEA--VGVQNVNEYFNNPDSE 73 IA L+ A V V++ +E P +E Sbjct: 306 ISTATTIAALSGATKVIVKSPHEAIGIPTAE 336 >gnl|CDD|178796 PRK00016, PRK00016, metal-binding heat shock protein; Provisional. Length = 159 Score = 26.8 bits (60), Expect = 1.4 Identities = 10/28 (35%), Positives = 14/28 (50%), Gaps = 5/28 (17%) Query: 13 NREKDIMMVSHLLALQKEILATFGLNNP 40 + E + M L++EILA GL P Sbjct: 132 DEEAEEM-----FGLEEEILAALGLPRP 154 >gnl|CDD|179938 PRK05105, PRK05105, O-succinylbenzoate synthase; Provisional. Length = 322 Score = 26.7 bits (60), Expect = 1.4 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Query: 3 AKVNIGLGSGNREKDIMMVSHLLA 26 AKV +GL R D M+V+ LL Sbjct: 132 AKVKVGLYEAVR--DGMLVNLLLE 153 >gnl|CDD|182838 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Provisional. Length = 672 Score = 24.8 bits (54), Expect = 5.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Query: 45 THLYNGIARLAEAVGVQNVNEYFNNPDSEQW 75 TH I RLAE V V + + D E W Sbjct: 457 THWLAEIQRLAEREPVAAVRDLIHGIDYESW 487 >gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase. Length = 338 Score = 23.9 bits (51), Expect = 9.7 Identities = 12/46 (26%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 2 DAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHL 47 D K+ IG+ R I + + LQ++ + +N+PF++T ++ Sbjct: 3 DKKIRIGINGFGR---IGRLVARVVLQRDDVELVAVNDPFITTEYM 45 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.132 0.382 Gapped Lambda K H 0.267 0.0631 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,242,561 Number of extensions: 63723 Number of successful extensions: 124 Number of sequences better than 10.0: 1 Number of HSP's gapped: 124 Number of HSP's successfully gapped: 10 Length of query: 76 Length of database: 5,994,473 Length adjustment: 46 Effective length of query: 30 Effective length of database: 5,000,505 Effective search space: 150015150 Effective search space used: 150015150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.2 bits)