RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781144|ref|YP_003065557.1| hypothetical protein CLIBASIA_05240 [Candidatus Liberibacter asiaticus str. psy62] (76 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 33.8 bits (77), Expect = 0.009 Identities = 17/76 (22%), Positives = 28/76 (36%), Gaps = 22/76 (28%) Query: 14 REKDI-MMVSHL-------LALQKEILATF-------GLNNPFVSTTHLY----NGIARL 54 DI + + L L KE++ + S + L+ G A+L Sbjct: 97 EGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQL 156 Query: 55 AEAV-GVQ-NVNEYFN 68 A+ G Q N ++YF Sbjct: 157 V-AIFGGQGNTDDYFE 171 >1xax_A Hypothetical UPF0054 protein HI0004; structural genomics, MMP, hydrolase, protein structure initiative, S2F, structure 2 function project; NMR {Haemophilus influenzae} Length = 154 Score = 24.6 bits (53), Expect = 5.6 Identities = 6/31 (19%), Positives = 17/31 (54%), Gaps = 5/31 (16%) Query: 13 NREKDIMMVSHLLALQKEILATFGLNNPFVS 43 + E + M +L+ +I+ G ++P+++ Sbjct: 127 DDEAEEM-----ESLETQIMQGLGFDDPYLA 152 >1xm5_A Hypothetical UPF0054 protein YBEY; structural genomics, protein structure initiative, nysgxrc target T842, PFAM family UPF0054, PSI; 2.70A {Escherichia coli} SCOP: d.92.1.15 Length = 155 Score = 24.2 bits (52), Expect = 6.9 Identities = 6/18 (33%), Positives = 12/18 (66%) Query: 26 ALQKEILATFGLNNPFVS 43 AL+ EI+ G +P+++ Sbjct: 135 ALETEIMLALGYEDPYIA 152 >2prr_A Alkylhydroperoxidase AHPD core: uncharacterized peroxidase-related protein; YP_296737.1, carboxymuconolactone decarboxylase family; HET: PGE; 2.15A {Ralstonia eutropha JMP134} SCOP: a.152.1.3 Length = 197 Score = 24.0 bits (51), Expect = 8.1 Identities = 6/26 (23%), Positives = 14/26 (53%) Query: 42 VSTTHLYNGIARLAEAVGVQNVNEYF 67 + T + R+A +G++ +E+F Sbjct: 163 AAITAFFGLSNRMANTIGMRPNDEFF 188 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.132 0.382 Gapped Lambda K H 0.267 0.0482 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 623,835 Number of extensions: 22463 Number of successful extensions: 48 Number of sequences better than 10.0: 1 Number of HSP's gapped: 48 Number of HSP's successfully gapped: 4 Length of query: 76 Length of database: 5,693,230 Length adjustment: 45 Effective length of query: 31 Effective length of database: 4,602,250 Effective search space: 142669750 Effective search space used: 142669750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.6 bits)