RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781145|ref|YP_003065558.1| hypothetical protein
CLIBASIA_05245 [Candidatus Liberibacter asiaticus str. psy62]
         (350 letters)



>gnl|CDD|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar
           to eukaryotic DPM1.  Proteins similar to eukaryotic
           DPM1, including enzymes from bacteria and archaea; DPM1
           is the catalytic subunit of eukaryotic
           dolichol-phosphate mannose (DPM) synthase. DPM synthase
           is required for synthesis of the
           glycosylphosphatidylinositol (GPI) anchor, N-glycan
           precursor, protein O-mannose, and C-mannose. In higher
           eukaryotes,the enzyme has three subunits, DPM1, DPM2 and
           DPM3. DPM is synthesized from dolichol phosphate and
           GDP-Man on the cytosolic surface of the ER membrane by
           DPM synthase and then is flipped onto the luminal side
           and used as a donor substrate. In lower eukaryotes, such
           as Saccharomyces cerevisiae and Trypanosoma brucei, DPM
           synthase consists of a single component (Dpm1p and
           TbDpm1, respectively) that possesses one predicted
           transmembrane region near the C terminus for anchoring
           to the ER membrane. In contrast, the Dpm1 homologues of
           higher eukaryotes, namely fission yeast, fungi, and
           animals, have no transmembrane region, suggesting the
           existence of adapter molecules for membrane anchoring.
           This family also includes bacteria and archaea DPM1_like
           enzymes. However, the enzyme structure and mechanism of
           function are not well understood. This protein family
           belongs to Glycosyltransferase 2 superfamily.
          Length = 224

 Score = 28.7 bits (65), Expect = 2.4
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 268 LVDRTGISDISSGF---SPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEI 318
           L+    +SD +SGF     E+L+ +     SL+ +    Q+EL+VR    G  I
Sbjct: 142 LLLGRKVSDPTSGFRAYRREVLEKL---IDSLVSKGYKFQLELLVRARRLGYRI 192


>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and
           22A1-like.  Aldehyde dehydrogenase family members
           ALDH15A1 (Saccharomyces cerevisiae YHR039C) and ALDH22A1
           (Arabidopsis thaliana, EC=1.2.1.3), and similar
           sequences, are in this CD. Significant improvement of
           stress tolerance in tobacco plants was observed by
           overexpressing the ALDH22A1 gene from maize (Zea mays)
           and was accompanied by a reduction of malondialdehyde
           derived from cellular lipid peroxidation.
          Length = 465

 Score = 27.3 bits (61), Expect = 6.5
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 297 IEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRD 341
           I  +   Q E    + A+  ++L R LL+ I+++Q+++  V  RD
Sbjct: 24  IAAARAAQREWAKTSFAERRKVL-RSLLKYILENQEEICRVACRD 67


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.321    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0562    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 4,361,108
Number of extensions: 232265
Number of successful extensions: 471
Number of sequences better than 10.0: 1
Number of HSP's gapped: 470
Number of HSP's successfully gapped: 4
Length of query: 350
Length of database: 6,263,737
Length adjustment: 95
Effective length of query: 255
Effective length of database: 4,210,882
Effective search space: 1073774910
Effective search space used: 1073774910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.5 bits)