RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781145|ref|YP_003065558.1| hypothetical protein CLIBASIA_05245 [Candidatus Liberibacter asiaticus str. psy62] (350 letters) >d1f32a_ d.62.1.1 (A:) Pepsin inhibitor-3 {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 147 Score = 27.2 bits (60), Expect = 2.2 Identities = 9/56 (16%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 175 HCFIGESLAASII--EIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNP 228 FI + + + +++T + +NQP + + P L+P Sbjct: 84 KLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAV-PAGGLSP 138 >d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 282 Score = 26.9 bits (59), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 47 VDAVSPDEFLIHPDSVDIEKSPIVGRK 73 + A D FL H +DI+ +PI R Sbjct: 6 LHAAMADTFLEHKCRLDIDSAPITARN 32 >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Score = 25.4 bits (54), Expect = 8.0 Identities = 10/52 (19%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Query: 119 EMIEYYELYVTIDYDGDG---IAELRRVIMAGGTGKDNILCNEEWNELPFTC 167 E+ EL+ ID D G EL+ + G+ + + Sbjct: 8 EIGGLKELFKMIDTDNSGTITFDELKDGLKRVGSELMESEIKDLMDAADIDK 59 >d2d69a2 d.58.9.1 (A:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 126 Score = 25.0 bits (55), Expect = 8.3 Identities = 6/24 (25%), Positives = 12/24 (50%), Gaps = 3/24 (12%) Query: 121 IEYYELYVTIDY---DGDGIAELR 141 +E+Y +V ++Y + I E Sbjct: 1 VEWYLDFVDLNYEPGRDELIVEYY 24 >d1h2vc3 a.118.1.14 (C:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 310 Score = 24.9 bits (54), Expect = 9.9 Identities = 15/78 (19%), Positives = 24/78 (30%), Gaps = 18/78 (23%) Query: 176 CFIG-ESLAASIIEIQKIKTVLL---------RQTLDNL--YWQNQPQTIV------QEG 217 + +S + S + K V L + W+N PQ I Sbjct: 72 LHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRT 131 Query: 218 SIIDPESVLNPQFGKPIR 235 I+D +V N F + Sbjct: 132 QIVDCAAVANWIFSSELS 149 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.138 0.402 Gapped Lambda K H 0.267 0.0691 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,358,520 Number of extensions: 65511 Number of successful extensions: 157 Number of sequences better than 10.0: 1 Number of HSP's gapped: 157 Number of HSP's successfully gapped: 12 Length of query: 350 Length of database: 2,407,596 Length adjustment: 86 Effective length of query: 264 Effective length of database: 1,226,816 Effective search space: 323879424 Effective search space used: 323879424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (24.3 bits)