RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >3f9m_A Glucokinase; hexokinase IV, alternative splicing, ATP- binding, diabetes mellitus, disease mutation, glycolysis, nucleotide-binding, polymorphism; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* (A:1-71,A:210-447) Length = 309 Score = 27.2 bits (60), Expect = 0.91 Identities = 13/43 (30%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Query: 55 EQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKEL 97 + L Q + +EK++Q I QL +E L +++R ++KE+ Sbjct: 6 HHHENLYFQGMKKEKVEQ--ILAEFQLQEEDLKKVMRRMQKEM 46 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 26.8 bits (59), Expect = 1.0 Identities = 13/78 (16%), Positives = 24/78 (30%), Gaps = 24/78 (30%) Query: 2 SPLTLLPI--RKKYPCIN-RLSH----KEISLQYLYQSVLTDDFSKYGRKVIKNLREEKP 54 SP L + RK+ + R + E L+ L + E Sbjct: 21 SPN--LNMKYRKR--QLVTREAQIKDWVENELEALKLEAEE-------------IPSEDQ 63 Query: 55 EQYLRLISQILPREKIKQ 72 ++L ++ + E Q Sbjct: 64 NEFLLERTREIHNEAESQ 81 >1yku_A Hypothetical protein PXO2-61; globin fold, unknown function; 1.49A {Bacillus anthracis} (A:) Length = 136 Score = 26.6 bits (59), Expect = 1.2 Identities = 16/74 (21%), Positives = 29/74 (39%), Gaps = 11/74 (14%) Query: 11 KKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKN-----------LREEKPEQYLR 59 K C +E + + V+ + Y ++IKN L+EE Q + Sbjct: 5 KCLLCRYLKERQEKFISDWKKKVIIRERDPYKEEIIKNGEHLLSAFIMYLKEEISLQEIE 64 Query: 60 LISQILPREKIKQD 73 + S+ + RE+I Sbjct: 65 ITSKKIARERIDAK 78 >2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A (A:) Length = 301 Score = 26.4 bits (57), Expect = 1.3 Identities = 11/67 (16%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Query: 15 CINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDG 74 + +++ + +Y R K L + P+ Y + P EK Sbjct: 221 LVIGQEGRQVFALGHSEYSCDTLKQEYERDRDKGLNIDVPKNYFK---HDNPNEKPLVRW 277 Query: 75 ITNGDQL 81 ++G+ L Sbjct: 278 RSHGNLL 284 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 25.9 bits (57), Expect = 2.2 Identities = 5/18 (27%), Positives = 10/18 (55%), Gaps = 2/18 (11%) Query: 78 GDQLTDEQLCEII--RSL 93 D ++ E L E++ R + Sbjct: 3 ADVMSIESLVEVVFYRGM 20 >1cza_N Hexokinase type I; structurally homologous domains; HET: GLC G6P ADP; 1.90A {Homo sapiens} (N:478-519,N:658-895) Length = 280 Score = 25.7 bits (56), Expect = 2.6 Identities = 5/18 (27%), Positives = 10/18 (55%) Query: 80 QLTDEQLCEIIRSLEKEL 97 LT + L E+ + + E+ Sbjct: 1 HLTKDMLLEVKKRMRAEM 18 >2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} (A:480-799) Length = 320 Score = 25.3 bits (54), Expect = 2.8 Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 13/54 (24%) Query: 67 REKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSA 120 E+I ++ I++ DQL ++L + D + + K+ K Sbjct: 14 AERIGEEYISDLDQL-------------RKLLSYVDDEAFIRDVAKVKQENKLK 54 >1bdf_A RNA polymerase alpha subunit; nucleotidyltransferase, assemble; 2.50A {Escherichia coli} (A:1-50,A:179-235) Length = 107 Score = 25.4 bits (56), Expect = 3.0 Identities = 10/45 (22%), Positives = 20/45 (44%) Query: 60 LISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFK 104 + Q +K+ + TNG +E + L ++L+ F D + Sbjct: 63 RVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLR 107 >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} (A:88-318) Length = 231 Score = 24.9 bits (52), Expect = 3.6 Identities = 7/45 (15%), Positives = 18/45 (40%) Query: 59 RLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDF 103 + + P + Q + D+ +E + ++ + +F DF Sbjct: 187 NIETPYEPPIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFRDF 231 >3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} (A:1-13,A:178-347) Length = 183 Score = 24.7 bits (54), Expect = 4.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 30 YQSVLTDDFSKYGRKVIKNLREEK 53 Y +LT D S G ++K+L +E+ Sbjct: 63 YDLILTGDLSGVGSPILKDLLKEE 86 >1abv_A Delta subunit of the F1F0-ATP synthase; ATP synthesis, F1-ATPase, spectroscopy; NMR {Escherichia coli} (A:) Length = 134 Score = 24.4 bits (53), Expect = 5.2 Identities = 13/71 (18%), Positives = 30/71 (42%), Gaps = 5/71 (7%) Query: 32 SVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGD-----QLTDEQL 86 +V + + G+ +I+ + E L + + + + D L+++QL Sbjct: 62 AVCGEQLDENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQL 121 Query: 87 CEIIRSLEKEL 97 +I ++EK L Sbjct: 122 AKISAAMEKRL 132 >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} (A:) Length = 81 Score = 24.6 bits (54), Expect = 5.4 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 46 IKNLREEKPEQY-LRLI--SQILPREKIKQD-GITNGDQL 81 +++ E + +R++ ++ E D GITNGD+L Sbjct: 39 AQSVSMPPREGHWIRVVNKDKVFSGECKLSDCGITNGDRL 78 >1cza_N Hexokinase type I; structurally homologous domains; HET: GLC G6P ADP; 1.90A {Homo sapiens} (N:1-72,N:210-447) Length = 310 Score = 24.5 bits (53), Expect = 5.4 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Query: 67 REKIKQDGITNGDQLTDEQLCEIIRSLEKELQ 98 +KI + +L+DE L +I+ KE++ Sbjct: 19 VKKIDK--YLYAMRLSDETLIDIMTRFRKEMK 48 >1ob8_A Holliday-junction resolvase; hydrolase, enzyme, homologous recombination, holliday junction resolving enzyme, nuclease, archaea; 1.8A {Sulfolobus solfataricus} (A:) Length = 135 Score = 23.7 bits (51), Expect = 8.4 Identities = 9/63 (14%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Query: 36 DDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEK 95 ++ K ++ L + ++ + I IK + L E+ +II +++ Sbjct: 58 ENKVKVKEHQVRKLLDFLSMFTMKGVPLI----AIKFKQVHEWRVLVPEKAEDIIVTIDN 113 Query: 96 ELQ 98 + Sbjct: 114 SIP 116 >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} (A:163-245) Length = 83 Score = 23.6 bits (51), Expect = 9.6 Identities = 9/58 (15%), Positives = 24/58 (41%), Gaps = 7/58 (12%) Query: 36 DDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSL 93 + ++I R + + S ++ +D +GD+L+ E+L + + + Sbjct: 27 ARLYEVLDQLIAAKRATPGDD---MTSLLIAA----RDDEGDGDRLSPEELRDTLLLM 77 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.315 0.132 0.362 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 835,937 Number of extensions: 35681 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 131 Number of HSP's successfully gapped: 35 Length of query: 122 Length of database: 4,956,049 Length adjustment: 73 Effective length of query: 49 Effective length of database: 2,488,284 Effective search space: 121925916 Effective search space used: 121925916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.1 bits)