RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 41.9 bits (98), Expect = 4e-05 Identities = 21/127 (16%), Positives = 39/127 (30%), Gaps = 41/127 (32%) Query: 1 MSPLTLLPIRKKYPCINRLSHKEI--SL-----QYLYQSVLTDDFSKYGRKVIKNLRE-- 51 M + P+ LSH + L + S L + F K L E Sbjct: 1 MDAYSTRPLT--------LSHGSLEHVLLVPTASFFIASQLQEQF-------NKILPEPT 45 Query: 52 ------EKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIF-TDF- 103 ++P L+ + L G + + ++ + + L L F + Sbjct: 46 EGFAADDEPTTPAELVGKFL--------GYVS-SLVEPSKVGQFDQVLNLCLTEFENCYL 96 Query: 104 KNKDAHS 110 + D H+ Sbjct: 97 EGNDIHA 103 Score = 28.4 bits (63), Expect = 0.46 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Query: 46 IKNLREEKPEQYLRLISQILPREKIKQDGIT--NGDQ 80 I NL +E+ + Y+ + LP KQ I+ NG + Sbjct: 341 ISNLTQEQVQDYVNKTNSHLPAG--KQVEISLVNGAK 375 Score = 25.7 bits (56), Expect = 2.7 Identities = 21/111 (18%), Positives = 37/111 (33%), Gaps = 33/111 (29%) Query: 9 IRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNL--REEKPEQ-YLRL---IS 62 I+ ++ L + + ++ G +++ L P++ YL L IS Sbjct: 188 IKFSAETLSELIRTTLDAEKVFT---------QGLNILEWLENPSNTPDKDYL-LSIPIS 237 Query: 63 QILPREKIKQDGITNGDQLTDEQLCEIIRSLEK---ELQIFTDFKNKDAHS 110 P I G+ QL + L EL+ + K HS Sbjct: 238 --CPL--I---GVI---QLA--HYVVTAKLLGFTPGELR--SYLKGATGHS 274 >2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 701 Score = 31.5 bits (71), Expect = 0.045 Identities = 12/77 (15%), Positives = 25/77 (32%), Gaps = 11/77 (14%) Query: 43 RKVIKNLREEKPEQYLRLISQILPREKI--------KQDGITNGDQLTDEQLCEIIRSL- 93 R+ I + + E+ ++ +KI G T+ T E L + + Sbjct: 23 REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMG 82 Query: 94 --EKELQIFTDFKNKDA 108 E + D ++ Sbjct: 83 FEEYINPVIVDERDIYK 99 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 26.9 bits (58), Expect = 1.3 Identities = 8/36 (22%), Positives = 18/36 (50%), Gaps = 7/36 (19%) Query: 84 EQLCEIIRSLEKELQIFTDFKNKD-AHSRETKETTK 118 E+ + ++ L+ L+++ D D A + K T + Sbjct: 18 EK--QALKKLQASLKLYAD----DSAPALAIKATME 47 >2qlw_A RHAU; mutarotase, isomerase; HET: MSE; 1.60A {Rhizobium leguminosarum BV} PDB: 2qlx_A* Length = 144 Score = 26.8 bits (59), Expect = 1.5 Identities = 6/31 (19%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Query: 49 LREEKPEQYLRLISQILP--REKIKQDGITN 77 L +Y + +I P + + Q G ++ Sbjct: 50 LNPGMEAEYRKRHDEIWPELVDLLHQSGASD 80 >2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Length = 342 Score = 26.6 bits (58), Expect = 1.6 Identities = 16/76 (21%), Positives = 32/76 (42%), Gaps = 10/76 (13%) Query: 45 VIKNLREEKPEQYLRLISQILPREKIKQDGITNG---DQLTD------EQLCEIIRSLEK 95 ++K PE+Y +LI + P + + G ++LT + + E +L K Sbjct: 245 LVKGENMHSPEKYAKLILKARPMFVEAKAYMFVGYSRNRLTINNMPSHQDIREFAEALVK 304 Query: 96 ELQIFTDFKNKDAHSR 111 L + +++ SR Sbjct: 305 HLPGY-HIEDEYEPSR 319 >3kks_A Integrase, IN; beta-strands flanked by alpha-helices, DNA binding protein; 2.20A {Bovine immunodeficiency virus R29} PDB: 3kkr_A Length = 152 Score = 25.1 bits (55), Expect = 3.8 Identities = 12/66 (18%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Query: 33 VLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRS 92 V + S + + EE Q I Q++ R + NG T ++ + + Sbjct: 19 VAVETNSGLV--EAQVIPEETALQVALCILQLIQRYTVLHLHSDNGPCFTAHRIENLCKY 76 Query: 93 LEKELQ 98 L Sbjct: 77 LGITKT 82 >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assembly S-adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Length = 295 Score = 25.4 bits (55), Expect = 3.9 Identities = 10/64 (15%), Positives = 20/64 (31%), Gaps = 8/64 (12%) Query: 43 RKVIKN--------LREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLE 94 K ++ L K E L + +IK +L+ + + + Sbjct: 227 NKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFY 286 Query: 95 KELQ 98 + LQ Sbjct: 287 RFLQ 290 >1yku_A Hypothetical protein PXO2-61; globin fold, unknown function; 1.49A {Bacillus anthracis} Length = 136 Score = 25.1 bits (55), Expect = 4.0 Identities = 16/74 (21%), Positives = 29/74 (39%), Gaps = 11/74 (14%) Query: 11 KKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKN-----------LREEKPEQYLR 59 K C +E + + V+ + Y ++IKN L+EE Q + Sbjct: 5 KCLLCRYLKERQEKFISDWKKKVIIRERDPYKEEIIKNGEHLLSAFIMYLKEEISLQEIE 64 Query: 60 LISQILPREKIKQD 73 + S+ + RE+I Sbjct: 65 ITSKKIARERIDAK 78 >1wj2_A Probable WRKY transcription factor 4; DNA-binding domain, zinc-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.79.1.1 Length = 78 Score = 25.2 bits (55), Expect = 4.3 Identities = 11/39 (28%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Query: 33 VLTDDFS--KYGRKVIKNLREEKPEQYLRLISQILPREK 69 +L D + KYG+KV+K P Y + + K Sbjct: 16 LLDDGYRWRKYGQKVVKG--NPYPRSYYKCTTPGCGVRK 52 >1o9i_A Pseudocatalase; oxidoreductase, hexamer, dimanganese catalase, metalloenzyme, preoxidase; HET: MES; 1.33A {Lactobacillus plantarum} SCOP: a.25.1.3 PDB: 1jkv_A 1jku_A Length = 266 Score = 24.9 bits (54), Expect = 5.0 Identities = 6/28 (21%), Positives = 11/28 (39%) Query: 25 SLQYLYQSVLTDDFSKYGRKVIKNLREE 52 + +L Q + KY ++ EE Sbjct: 39 MMSFLSQGWASTGAEKYKDLLLDTGTEE 66 >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A Length = 531 Score = 24.6 bits (53), Expect = 6.1 Identities = 15/45 (33%), Positives = 21/45 (46%) Query: 7 LPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLRE 51 LP+R P + S K I LQ +Y+ D + G V K L+ Sbjct: 320 LPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQS 364 >3fyd_A Probable dimethyladenosine transferase; rossman fold, rRNA methylase, ribosomal assembly, methyltransferase, RNA-binding; 1.75A {Methanocaldococcus jannaschii} PDB: 3fyc_A* Length = 263 Score = 24.3 bits (52), Expect = 7.1 Identities = 10/56 (17%), Positives = 18/56 (32%) Query: 43 RKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQ 98 K L K E L + +IK +L+ + + + + LQ Sbjct: 206 IDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQ 261 >2cru_A Programmed cell death protein 5; three helix bundle, apoptosis, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.6.1 PDB: 2k6b_A Length = 118 Score = 24.3 bits (53), Expect = 7.9 Identities = 14/74 (18%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Query: 31 QSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEII 90 S+L + R + NL KPE+ + + ++ ++ + G + +++++ L EI+ Sbjct: 40 NSILAQVLDQSARARLSNLALVKPEKTKAVENYLI---QMARYGQLSE-KVSEQGLIEIL 95 Query: 91 RSLEKELQIFTDFK 104 + + ++ + T K Sbjct: 96 KKVSQQTEKTTTVK 109 >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Length = 244 Score = 23.9 bits (51), Expect = 8.6 Identities = 6/36 (16%), Positives = 16/36 (44%) Query: 60 LISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEK 95 + ++ +K GI + + ++ EQ + S + Sbjct: 206 IFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYKL 241 >3c9a_A Protein giant-lens; argos, EGF, EGFR inhibitor, inhibitor, developmental protein, glycoprotein, secreted, sensory transduction, vision; 1.60A {Drosophila melanogaster} PDB: 3cgu_A Length = 223 Score = 23.8 bits (51), Expect = 9.4 Identities = 6/25 (24%), Positives = 12/25 (48%) Query: 71 KQDGITNGDQLTDEQLCEIIRSLEK 95 +DG T D+ ++C+ + L Sbjct: 64 VEDGHTIADKTRHYKMCQPVHKLPV 88 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.132 0.362 Gapped Lambda K H 0.267 0.0580 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 974,721 Number of extensions: 43143 Number of successful extensions: 180 Number of sequences better than 10.0: 1 Number of HSP's gapped: 179 Number of HSP's successfully gapped: 44 Length of query: 122 Length of database: 5,693,230 Length adjustment: 81 Effective length of query: 41 Effective length of database: 3,729,466 Effective search space: 152908106 Effective search space used: 152908106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.4 bits)