RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Score = 28.9 bits (63), Expect = 0.15 Identities = 7/55 (12%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Query: 18 RLSHKEISLQYLYQSV---LTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREK 69 + ++ L ++ L + V +R + +L+ + EK Sbjct: 337 AVDGPVPTIDSLSAALDTALAPEIRARATTVADTIRADGTTVAAQLLFDAVSLEK 391 >d1jkva_ a.25.1.3 (A:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]} Length = 266 Score = 24.9 bits (54), Expect = 1.9 Identities = 7/28 (25%), Positives = 11/28 (39%) Query: 25 SLQYLYQSVLTDDFSKYGRKVIKNLREE 52 + YL Q + KY ++ EE Sbjct: 39 MMSYLSQGWASTGAEKYKDLLLDTGTEE 66 >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Score = 24.9 bits (54), Expect = 2.2 Identities = 15/45 (33%), Positives = 21/45 (46%) Query: 7 LPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLRE 51 LP+R P + S K I LQ +Y+ D + G V K L+ Sbjct: 318 LPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQS 362 >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Length = 116 Score = 24.6 bits (53), Expect = 2.4 Identities = 5/26 (19%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Query: 30 YQSV----LTDDFSKYGRKVIKNLRE 51 ++ + + + +KYG ++K+L Sbjct: 1 FRKIALVGASKNPAKYGNIILKDLLS 26 >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 129 Score = 24.6 bits (53), Expect = 2.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 35 TDDFSKYGRKVIKNLREEKPEQ 56 ++D K G +V KNL+E K + Sbjct: 17 SNDPKKLGYEVFKNLKEYKKGK 38 >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Length = 235 Score = 24.4 bits (52), Expect = 3.2 Identities = 6/36 (16%), Positives = 16/36 (44%) Query: 60 LISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEK 95 + ++ +K GI + + ++ EQ + S + Sbjct: 197 IFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYKL 232 >d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 366 Score = 23.8 bits (50), Expect = 4.8 Identities = 7/48 (14%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Query: 48 NLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEK 95 L++ E L++ + + I N +T + + + I + ++ Sbjct: 315 KLKDASREDILKVAKAATA----EGETIHNAFNVTADDVADAIFAADQ 358 >d1wj2a_ g.79.1.1 (A:) WRKY DNA-binding protein 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 71 Score = 23.6 bits (51), Expect = 5.1 Identities = 11/39 (28%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Query: 33 VLTDDFS--KYGRKVIKNLREEKPEQYLRLISQILPREK 69 +L D + KYG+KV+K P Y + + K Sbjct: 9 LLDDGYRWRKYGQKVVKG--NPYPRSYYKCTTPGCGVRK 45 >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291 Score = 23.0 bits (49), Expect = 7.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 83 DEQLCEIIRSLEKELQIFTDF 103 +E +C +I+ +LQI TDF Sbjct: 24 EEIICGLIKGGAAKLQIITDF 44 >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Score = 22.9 bits (48), Expect = 9.2 Identities = 10/35 (28%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 50 REEKPEQYLRLISQILPREKIKQDGITNGDQLTDE 84 RE+ +YL+ S++L R +++ D + + L E Sbjct: 4 REKVAMEYLQSASRVLTRSQLR-DVVASSHLLQSE 37 >d1seda_ a.219.1.1 (A:) Hypothetical protein YhaI {Bacillus subtilis [TaxId: 1423]} Length = 112 Score = 22.8 bits (49), Expect = 9.5 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Query: 18 RLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPR-EKIKQDGIT 76 R+ E +Q L ++V D + Y + K L +E+ E +R+ ++ K G Sbjct: 6 RIERLEYYIQLLVKTVDMDRYPFYALLIDKGLSKEEGEAVMRICDELSEELATQKAQGFV 65 Query: 77 NGDQLTDE 84 D+L Sbjct: 66 TFDKLLAL 73 >d1j3kc_ d.117.1.1 (C:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 326 Score = 22.7 bits (48), Expect = 9.7 Identities = 12/42 (28%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Query: 32 SVLTDDFSKYGRKVIKNLREEKPEQYLRLISQILPREKIKQD 73 S+ +DF Y K E QYL +I I+ + D Sbjct: 24 SIHPNDFQIYNSLKYKYHPEY---QYLNIIYDIMMNGNKQSD 62 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.315 0.132 0.362 Gapped Lambda K H 0.267 0.0506 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 424,032 Number of extensions: 18976 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's gapped: 76 Number of HSP's successfully gapped: 26 Length of query: 122 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 47 Effective length of database: 1,377,846 Effective search space: 64758762 Effective search space used: 64758762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.4 bits)