BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781146|ref|YP_003065559.1| hypothetical protein CLIBASIA_05265 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 247 bits (630), Expect = 5e-68, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%) Query: 1 MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRL 60 MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRL Sbjct: 1 MSPLTLLPIRKKYPCINRLSHKEISLQYLYQSVLTDDFSKYGRKVIKNLREEKPEQYLRL 60 Query: 61 ISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSA 120 ISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSA Sbjct: 61 ISQILPREKIKQDGITNGDQLTDEQLCEIIRSLEKELQIFTDFKNKDAHSRETKETTKSA 120 Query: 121 SS 122 SS Sbjct: 121 SS 122 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 23.1 bits (48), Expect = 1.5, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Query: 45 VIKNLREEKPEQYLRLISQILPREKIKQDGITNGDQLTDEQLCEIIRSL 93 +KN+RE + R + QI D + NG + D QL + I+ L Sbjct: 942 ALKNIRE-----WYRKVHQIWKDNSSLDDALINGFLMLDSQLFKRIQKL 985 >gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 21.6 bits (44), Expect = 5.0, Method: Compositional matrix adjust. Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 41 YGRKVIKNLREEKPEQY 57 YG K I NLR + PE + Sbjct: 70 YGIKSILNLRGKLPESW 86 >gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str. psy62] Length = 781 Score = 21.2 bits (43), Expect = 6.3, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 60 LISQILPREKIKQDGITNGDQLTDEQLCEIIRS 92 LI ++ R+ I + + L D+QL I+RS Sbjct: 106 LIIDLIERKIINHLFFSGNNNLKDDQLKMIVRS 138 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.132 0.362 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,638 Number of Sequences: 1233 Number of extensions: 2910 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 122 length of database: 328,796 effective HSP length: 64 effective length of query: 58 effective length of database: 249,884 effective search space: 14493272 effective search space used: 14493272 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 33 (17.3 bits)