>TIGR02684 dnstrm_HI1420 probable addiction module antidote protein; InterPro: IPR014057 Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the downstream member of a gene pair. It is a predicted DNA-binding protein from a clade within the helix-turn-helix family IPR001387 from INTERPRO. These gene pairs, when found on the bacterial chromosome, are located often with prophage regions, but also both in integrated plasmid regions and in housekeeping gene regions. Analysis suggests that the gene pair may serve as an addiction module..

Probab=97.54 E-value=0.00017 Score=47.56 Aligned_cols=57 Identities=16% Similarity=0.292 Sum_probs=49.8 Q ss_pred HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCHH Q ss_conf 99999999999983994999999863429999887558999448999999999289999 Q gi|254781147|r 20 MIFVNNFRNIRKEAKLTQKEIRNRTGFAQSWISELETGKSTINIDNMIILAHTLDTPLW 78 (83) Q Consensus 20 ~~~g~~ir~~R~~~gltq~ela~~~gis~~~is~iE~G~~~~~~~~l~~la~al~i~~~ 78 (83) T Consensus 33 ~~~~~ALG~iArArGMtq--lA~~tGlsREsLYkALs~~GnP~f~T~lkV~~ALG~~L~ 89 (91) T TIGR02684 33 ALIAAALGVIARARGMTQ--LAKKTGLSRESLYKALSGGGNPTFDTILKVTKALGLKLT 89 (91) T ss_pred HHHHHHHHHHHHHCCHHH--HHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHCCCEEE T ss_conf 899999889986516578--999828767887887356889566888999984086020

HHsearch alignment for GI: 254781147 and conserved domain: TIGR02684