RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781148|ref|YP_003065561.1| hypothetical protein CLIBASIA_05275 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) >gnl|CDD|144390 pfam00772, DnaB, DnaB-like helicase N terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This N-terminal domain is required both for interaction with other proteins in the primosome and for DnaB helicase activity. Length = 103 Score = 37.2 bits (87), Expect = 0.001 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 21 IGLEQEILGSLLL-KGNLQPIISFLDAQHFIDPIHSEVFRAI 61 I EQ +LG+LLL + + L + F DP H +F AI Sbjct: 6 IEAEQAVLGALLLDPEAIDEVADILKPEDFYDPAHRLIFEAI 47 >gnl|CDD|30653 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair]. Length = 435 Score = 32.1 bits (73), Expect = 0.035 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 21 IGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITR 63 I EQ +LG +LL + ++ + L + F P H +++AI Sbjct: 7 IEAEQAVLGGILLDPDAIERVSERLRPEDFYRPAHRLIYQAILD 50 >gnl|CDD|147709 pfam05704, Caps_synth, Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae. Length = 279 Score = 25.3 bits (56), Expect = 4.0 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 1 MLSDFSKKYYSRNNNSIYYFI 21 L D +Y+ + N+ I YF+ Sbjct: 183 FLRDLLLEYWKKYNSLIDYFL 203 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.140 0.403 Gapped Lambda K H 0.267 0.0746 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 824,443 Number of extensions: 34860 Number of successful extensions: 98 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 6 Length of query: 69 Length of database: 6,263,737 Length adjustment: 40 Effective length of query: 29 Effective length of database: 5,399,377 Effective search space: 156581933 Effective search space used: 156581933 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.4 bits)