RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781148|ref|YP_003065561.1| hypothetical protein CLIBASIA_05275 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Length = 454 Score = 40.6 bits (94), Expect = 9e-05 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 21 IGLEQEILGSLLL-KGNLQPIISFLDAQHFIDPIHSEVFRAITR 63 I EQ +LG++ L L P L + F H ++F A+ R Sbjct: 14 IEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLR 57 >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Length = 444 Score = 36.1 bits (82), Expect = 0.002 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 24 EQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAITR 63 EQ +LGS+L + L L +HF H ++ + Sbjct: 18 EQAVLGSILTEPELIKECP-LTPEHFSPGKHFNIYFTMQD 56 >3gxv_A Replicative DNA helicase; hexameric helicase, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication; 2.20A {Helicobacter pylori} PDB: 3gxv_D 3gxv_C Length = 123 Score = 34.5 bits (79), Expect = 0.006 Identities = 8/44 (18%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 21 IGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITR 63 +E+ +L ++L + ++ + S L+ F P + F + Sbjct: 11 QNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALK 54 >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Length = 444 Score = 33.4 bits (75), Expect = 0.012 Identities = 11/45 (24%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 21 IGLEQEILGSLLLKGN-LQPIISFLDA-QHFIDPIHSEVFRAITR 63 + EQ +LGS+LL + + + L + + F H +++ A+ Sbjct: 10 LEAEQSVLGSILLDSDVMDEVEGLLPSPEAFYAEAHRKIYAAMQA 54 >2r5u_A Replicative DNA helicase; DNAB, primase, replication, ATP-binding, autocatalytic cleavage, DNA replication, DNA-binding, endonuclease; 1.90A {Mycobacterium tuberculosis} Length = 200 Score = 32.0 bits (72), Expect = 0.033 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 21 IGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAI 61 + EQ +LG +LL + + ++ L F P H V+ AI Sbjct: 31 LAAEQSVLGGMLLSKDAIADVLERLRPGDFYRPAHQNVYDAI 72 >1b79_A DNAB helicase; hexamer, DNA replication; 2.30A {Escherichia coli} SCOP: a.81.1.1 PDB: 1jwe_A Length = 119 Score = 31.5 bits (71), Expect = 0.051 Identities = 12/44 (27%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Query: 21 IGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVFRAITR 63 I EQ +LG L+L + + A F H +F + R Sbjct: 21 IEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMAR 64 >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Score = 28.0 bits (62), Expect = 0.51 Identities = 6/23 (26%), Positives = 11/23 (47%) Query: 2 LSDFSKKYYSRNNNSIYYFIGLE 24 L ++ K + + N + I LE Sbjct: 207 LHNYVKYFMNPNRPKVLNVISLE 229 >2r6a_C DNAG primase, helicase binding domain, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_G 1z8s_A* Length = 143 Score = 27.4 bits (60), Expect = 0.79 Identities = 5/38 (13%), Positives = 14/38 (36%) Query: 24 EQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRAI 61 E+ +L ++ ++ ++ F H + I Sbjct: 10 ERLLLAHMMRSRDVALVVQERIGGRFNIEEHRALAAYI 47 >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Length = 1706 Score = 26.8 bits (59), Expect = 1.3 Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 40 IISFLDAQHFIDPIHSE 56 +F+DA+H +DPI++ Sbjct: 64 TCAFIDAEHALDPIYAR 80 >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* Length = 397 Score = 24.9 bits (54), Expect = 4.4 Identities = 6/23 (26%), Positives = 11/23 (47%) Query: 2 LSDFSKKYYSRNNNSIYYFIGLE 24 L ++ K + + N + I LE Sbjct: 116 LHNYVKYFMNPNRPKVLNVISLE 138 >1y7e_A Probable M18-family aminopeptidase 1; aminopeptidase I, borrelia burgdorferi B31, YSCI, structural genomics, PSI; 3.20A {Borrelia burgdorferi} SCOP: b.49.3.1 c.56.5.4 Length = 458 Score = 23.8 bits (51), Expect = 9.7 Identities = 5/21 (23%), Positives = 10/21 (47%) Query: 7 KKYYSRNNNSIYYFIGLEQEI 27 K +Y+ S+ + I + I Sbjct: 65 KIFYTCREKSVAFAIIGKNPI 85 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.323 0.140 0.403 Gapped Lambda K H 0.267 0.0568 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 566,891 Number of extensions: 19790 Number of successful extensions: 66 Number of sequences better than 10.0: 1 Number of HSP's gapped: 62 Number of HSP's successfully gapped: 14 Length of query: 69 Length of database: 5,693,230 Length adjustment: 39 Effective length of query: 30 Effective length of database: 4,747,714 Effective search space: 142431420 Effective search space used: 142431420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.4 bits)