BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254781148|ref|YP_003065561.1| hypothetical protein
CLIBASIA_05275 [Candidatus Liberibacter asiaticus str. psy62]
         (69 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254781148|ref|YP_003065561.1| hypothetical protein CLIBASIA_05275 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 69

 Score =  144 bits (362), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 69/69 (100%), Positives = 69/69 (100%)

Query: 1  MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRA 60
          MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRA
Sbjct: 1  MLSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVFRA 60

Query: 61 ITRKTTNEC 69
          ITRKTTNEC
Sbjct: 61 ITRKTTNEC 69


>gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 623

 Score = 26.2 bits (56), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 5/33 (15%)

Query: 4  DFSKKYYSRNNNSIY-----YFIGLEQEILGSL 31
          D S K YSR   +I+     +F GLEQE+L SL
Sbjct: 28 DSSIKDYSRQLTNIFLKDKVFFDGLEQELLASL 60


>gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 504

 Score = 25.8 bits (55), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 6  SKKYYSRNNNSIYYFIGLEQEILGSLLLKGN-LQPIISFLDAQHFIDPIHSEVF 58
          S +Y    NN     I  EQ +LG++L+       +  FL   HF + IH ++F
Sbjct: 17 SSQYRESPNN-----IEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIF 65


>gi|254780654|ref|YP_003065067.1| Glyceraldehyde 3-Phosphate Dehydrogenase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 333

 Score = 24.6 bits (52), Expect = 0.28,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 34  KGNLQPIISFLDAQHFIDPIHSEVFRA 60
           KG +  + S+   QH +D  HS+++R+
Sbjct: 171 KGYMTTVHSYTGDQHVLDAGHSDLYRS 197


>gi|254780168|ref|YP_003064581.1| monooxygenase FAD-binding protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 380

 Score = 24.3 bits (51), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 21/51 (41%)

Query: 2   LSDFSKKYYSRNNNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDP 52
           LS FS K YSRNN    Y +     +   LL     QP+     + H   P
Sbjct: 79  LSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHIQTQPLARLHLSTHITHP 129


>537021.9.peg.1142_1 
          Length = 218

 Score = 22.3 bits (46), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 14  NNSIYYFIGLEQEILGSLLLKGNLQPIISFLDAQ-HFIDPIHSEVFRAITRKTTN 67
           ++ +Y    L   ILG  L++  L P+IS  + Q  F DP  +E  +A+    T+
Sbjct: 59  SSQVYRAKALVIGILGEELIRKTLVPLISGKEPQLDFSDP--TEYIKALINGITH 111


>gi|254780624|ref|YP_003065037.1| ubiquinone/menaquinone biosynthesis methyltransferase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 265

 Score = 21.9 bits (45), Expect = 2.2,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 15/30 (50%)

Query: 33  LKGNLQPIISFLDAQHFIDPIHSEVFRAIT 62
            K NLQ  I+F++A     P  +  F A T
Sbjct: 116 FKENLQDCITFIEANAETLPFEANSFDACT 145


>gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62]
          Length = 363

 Score = 20.8 bits (42), Expect = 5.0,   Method: Composition-based stats.
 Identities = 6/14 (42%), Positives = 12/14 (85%)

Query: 42  SFLDAQHFIDPIHS 55
           +F+DA+H +D I++
Sbjct: 99  AFVDAEHALDSIYA 112


>gi|254780472|ref|YP_003064885.1| cytochrome o ubiquinol oxidase subunit III [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 210

 Score = 19.6 bits (39), Expect = 9.0,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 17  IYYFIGLEQEILGSLLLKGNLQPIISFLDAQHFIDPIHSEVF 58
           I+ F+ L  +IL   L+ GN + +I      HF+D I   VF
Sbjct: 161 IWLFV-LVIQILKKGLISGNQRRLICLSMFWHFLDLIWICVF 201


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.323    0.140    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 45,093
Number of Sequences: 1233
Number of extensions: 1547
Number of successful extensions: 13
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of query: 69
length of database: 328,796
effective HSP length: 40
effective length of query: 29
effective length of database: 279,476
effective search space:  8104804
effective search space used:  8104804
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.0 bits)
S2: 31 (16.5 bits)