>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase). A similar protein is also found in a few bacteria. This subfamily consists of the non-catalytic beta subunit.

Probab=93.55 E-value=0.066 Score=33.49 Aligned_cols=44 Identities=16% Similarity=0.165 Sum_probs=36.7 Q ss_pred CCCCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHH Q ss_conf 851113777776553016836887068741488999999999630 Q gi|254781149|r 124 DIKWGLQSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAM 168 (266) Q Consensus 124 Gi~TG~~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~ 168 (266) T Consensus 52 ~l~TGIkaID~l~p-ig~GQR~gIfgg~GvGKs~L~~~i~~~~~~ 95 (276) T cd01135 52 MIQTGISAIDGMNT-LVRGQKIPIFSGSGLPHNELAAQIARQAGV 95 (276) T ss_pred CCCCCCEEEECCCC-CCCCCEEEECCCCCCCHHHHHHHHHHHHHH T ss_conf 32258535405467-236766332057886367899999998775

HHsearch alignment for GI: 254781149 and conserved domain: cd01135