>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.

Probab=96.54 E-value=0.012 Score=38.76 Aligned_cols=124 Identities=15% Similarity=0.158 Sum_probs=81.2 Q ss_pred HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEECC---CCCHHHHHHHHHHHHHCCCCCCCCHHHC Q ss_conf 7777765530168368870687414889999999996302232364116---7534899999999630223234785550 Q gi|254781149|r 130 QSVDHLMGGVQLRELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSL---EMDREKLGARALSNLLYPSSSRIPYLNL 206 (266) Q Consensus 130 ~~LD~~~gG~~~g~LiviaaRP~mGKTa~alnia~~~a~~g~~Vl~fSl---EMs~~ql~~R~ls~~t~~~~s~I~~~~l 206 (266) T Consensus 13 ~il~~is~~i~~Ge~~~liG~nGsGKTTLl~~i~G~~~~~~G~I~~~g~~i~~~~~~~~~~~i-~~v~Q-~l~~~~l~~~ 90 (180) T cd03214 13 TVLDDLSLSIEAGEIVGILGPNGAGKSTLLKTLAGLLKPSSGEILLDGKDLASLSPKELARKI-AYVPQ-ALELLGLAHL 90 (180) T ss_pred EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHCCC-CHHHH-HHHHCCCHHH T ss_conf 988043778869979999989998899999999579899872899999998969999995546-49999-9998599778 Q ss_pred CC---CCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCHH-----HHHHHHHHHHHHH Q ss_conf 17---8899899999999999997299547479988989-----9999999999994 Q gi|254781149|r 207 IR---GEINQEQYRISQGICEKLQDFPLIIDDRPSPGIM-----EFVHVANGLRNKH 255 (266) Q Consensus 207 ~~---g~l~~~e~~~i~~a~~~l~~~pl~IdD~~~~ti~-----~ira~aR~~k~k~ 255 (266) T Consensus 91 ~~~~~~~LSGGqkQrv~iA~aL~~~P~ililDEPts~LD~~~~~~i~~~i~~l~~~~ 147 (180) T cd03214 91 ADRPFNELSGGERQRVLLARALAQEPPILLLDEPTSHLDIAHQIELLELLRRLARER 147 (180) T ss_pred HCCCHHHCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHC T ss_conf 649910379999999999999986896478858754479999999999999999846

HHsearch alignment for GI: 254781149 and conserved domain: cd03214