RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781150|ref|YP_003065563.1| hypothetical protein CLIBASIA_05285 [Candidatus Liberibacter asiaticus str. psy62] (33 letters) >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} (A:179-444) Length = 266 Score = 27.5 bits (59), Expect = 0.71 Identities = 11/28 (39%), Positives = 14/28 (50%) Query: 2 DFIVAKQRNGPIESVSLFVDMPYSVIKD 29 + IV KQRNGP +V L + D Sbjct: 234 EIIVGKQRNGPTGTVELQFHASHVRFND 261 >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} (A:50-315) Length = 266 Score = 26.7 bits (57), Expect = 1.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 4 IVAKQRNGPIESVSLFVDMPYSVIKD 29 I+AK R+GP+ +VSL Y + Sbjct: 233 IIAKHRDGPVGTVSLAFIKEYGNFVN 258 >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A (A:191-454) Length = 264 Score = 26.3 bits (56), Expect = 1.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 3 FIVAKQRNGPIESVSLFVDMPYSVIKDGKE 32 I+AKQRNGP+ +V L Y+ + + Sbjct: 224 IIIAKQRNGPVGTVQLAFIKEYNKFVNLER 253 >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} (A:184-444) Length = 261 Score = 25.6 bits (54), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 4 IVAKQRNGPIESVSLFVDMPYSVIKD 29 I+AK R+GP+ +VSL Y + Sbjct: 228 IIAKHRDGPVGTVSLAFIKEYGNFVN 253 >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} (A:23-279) Length = 257 Score = 25.2 bits (53), Expect = 2.9 Identities = 6/25 (24%), Positives = 9/25 (36%) Query: 3 FIVAKQRNGPIESVSLFVDMPYSVI 27 F V+K G + F V+ Sbjct: 214 FGVSKANYGAPFADRWFRRHDGGVL 238 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.138 0.421 Gapped Lambda K H 0.267 0.0364 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 240,705 Number of extensions: 4632 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's gapped: 22 Number of HSP's successfully gapped: 6 Length of query: 33 Length of database: 4,956,049 Length adjustment: 7 Effective length of query: 26 Effective length of database: 4,719,414 Effective search space: 122704764 Effective search space used: 122704764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (24.0 bits)