RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781151|ref|YP_003065564.1| hypothetical protein CLIBASIA_05290 [Candidatus Liberibacter asiaticus str. psy62] (38 letters) >gnl|CDD|148622 pfam07120, DUF1376, Protein of unknown function (DUF1376). This family consists of several hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown. Length = 88 Score = 34.5 bits (80), Expect = 0.006 Identities = 10/32 (31%), Positives = 19/32 (59%) Query: 6 PWYKRYPANFISGILELTLEQKGAYSIILDLI 37 P+Y + +F++ L+ E+ GAY+ +LD Sbjct: 1 PYYPLHIGDFLADTAHLSAEEHGAYTRLLDAY 32 >gnl|CDD|151091 pfam10546, P63C, P63C domain. This domain was identified by Iyer and colleagues. Length = 94 Score = 23.9 bits (52), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 5 RPWYKRYPANFISGILEL 22 +PW KR+P +F I L Sbjct: 11 QPWEKRFPDDFYEEIFRL 28 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.143 0.432 Gapped Lambda K H 0.267 0.0788 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 614,273 Number of extensions: 19623 Number of successful extensions: 31 Number of sequences better than 10.0: 1 Number of HSP's gapped: 31 Number of HSP's successfully gapped: 3 Length of query: 38 Length of database: 5,994,473 Length adjustment: 12 Effective length of query: 26 Effective length of database: 5,735,177 Effective search space: 149114602 Effective search space used: 149114602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (22.9 bits)