HHsearch alignment for GI: 254781152 and conserved domain: COG3756

>COG3756 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=97.87  E-value=1.4e-05  Score=53.67  Aligned_cols=104  Identities=25%  Similarity=0.383  Sum_probs=73.2

Q ss_pred             CCCHHCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCCEECHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             92100048987502799977719999999999999985391899389242189999999756778874220111245666
Q gi|254781152|r    1 MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIKSSQMR   80 (155)
Q Consensus         1 lv~MYdrGgPL~~N~r~LAg~CGCSvKkFr~aLd~Ll~~GKI~l~DG~LWN~RVEeEL~n~sEer~~agRkGg~~S~Q~R   80 (155)
T Consensus        30 L~~yw~t~~pip~d~~~~a~~a~~s~krw~av~~~L~~Ff--~l~~~~w~~KR~~eeiaa~~e~~a~~s-~a~~~~~~~~  106 (153)
T COG3756          30 LMAYWATEKPIPADKAALARAAALSKKRWRAVDAILDEFF--SLQGDGWHNKRCDEEIAAQVEKEAKAS-GAAGKSVQAL  106 (153)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--HHCCCHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCCC
T ss_conf             9999865999996389999999984888877079999998--524444988888899999998677776-6302555663


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHCCCCCCCCCCCCCHHH
Q ss_conf             6777655664301564786308411256447642343
Q gi|254781152|r   81 ILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEK  117 (155)
Q Consensus        81 ~~~kk~n~~fq~~~~~~~~~~~~~~~~~~~~~~~~~~  117 (155)
T Consensus       107 --rtr~h~~~~t~~~~--------slt~~qk~~~fs~  133 (153)
T COG3756         107 --RTRAHGAAQTGALP--------SLTQSQKPSDFSP  133 (153)
T ss_pred             --CCHHHHHHHHCCCC--------CCCCCCCCCCCCC
T ss_conf             --21578988602363--------2013557867683