RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] (155 letters) >2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (D:363-647) Length = 285 Score = 30.2 bits (68), Expect = 0.13 Identities = 11/66 (16%), Positives = 28/66 (42%), Gaps = 17/66 (25%) Query: 27 RRWRNIRAILEK------------FNKIFIQEGNIYNV-----RVEKEIIKASEERQENG 69 + +N++ + + N+I++ +GN+ + V++E E+ + G Sbjct: 58 KTKKNVKINIFEKEEGKNLLGPSILNEIYVYDGNVIGIPESFDGVKEEFKDFLEKGKSEG 117 Query: 70 RKGGIK 75 GI+ Sbjct: 118 VATGIR 123 >2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (C:359-648) Length = 290 Score = 30.2 bits (68), Expect = 0.14 Identities = 14/66 (21%), Positives = 29/66 (43%), Gaps = 17/66 (25%) Query: 27 RRWRNIRA-ILEK-----------FNKIFIQEGNIYNV-----RVEKEIIKASEERQENG 69 + +N++ I EK N+I++ +GN+ + V++E E+ + G Sbjct: 62 KTKKNVKINIFEKEEGKNLLGPSILNEIYVYDGNVIGIPESFDGVKEEFKDFLEKGKSEG 121 Query: 70 RKGGIK 75 GI+ Sbjct: 122 VATGIR 127 >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} (A:1-165,A:341-398) Length = 223 Score = 26.3 bits (57), Expect = 2.2 Identities = 12/45 (26%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Query: 11 IPDNDKYIAGVCGCSIRRWRNI-RAILEKFNKIFIQEGNIYNVRV 54 +PD DK + + +++ R + +AI+ +++I I E + V+V Sbjct: 151 LPDRDKAMEKIRDLTMKYNRALMQAIM--WDRINIAE--VVGVQV 191 >2fz6_A Hydrophobin-1; beta barrel, pseudo-merohedral twinning, amphiphIle, surface active protein; 2.10A {Hypocrea jecorina} PDB: 2gvm_A* (A:) Length = 75 Score = 25.1 bits (55), Expect = 4.1 Identities = 6/9 (66%), Positives = 6/9 (66%) Query: 128 ALCCATDVL 136 CCAT VL Sbjct: 16 PQCCATQVL 24 >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae TIGR4} (A:220-285) Length = 66 Score = 25.3 bits (56), Expect = 4.2 Identities = 14/53 (26%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Query: 4 LYDRGGSIPDNDK----YIAGVCGCSIRRWRNIRAI--LEKFNKIFIQEGNIY 50 L GG NDK I G S +++ +A+ L K KI + Sbjct: 14 LESNGGFXTLNDKSSPDDIKATFGISKGQFK--KALGGLXKAGKIKQDQFGTE 64 >2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} (C:) Length = 309 Score = 25.3 bits (54), Expect = 4.4 Identities = 9/54 (16%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 10 SIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIKASE 63 + D++I + C ++++ EK +I +E N+ V + + Sbjct: 6 FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNV--QEVRCPVTVCGD 57 >1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} (A:1-344) Length = 344 Score = 24.9 bits (53), Expect = 5.1 Identities = 8/44 (18%), Positives = 14/44 (31%) Query: 10 SIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVR 53 P D A + I+ + I QE N+ ++ Sbjct: 39 GKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDID 82 >2b97_A Hydrophobin II, hfbii; ultra-high resolution, surfactant, amphiphilic, surface active protein; 0.75A {Hypocrea jecorina} (A:) Length = 71 Score = 25.1 bits (55), Expect = 5.2 Identities = 7/9 (77%), Positives = 8/9 (88%) Query: 128 ALCCATDVL 136 LCCAT+VL Sbjct: 11 PLCCATNVL 19 >2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* (A:349-534) Length = 186 Score = 24.7 bits (54), Expect = 5.4 Identities = 7/26 (26%), Positives = 14/26 (53%) Query: 39 FNKIFIQEGNIYNVRVEKEIIKASEE 64 N++ + +G+IY + K+ EE Sbjct: 83 ANEVVVYKGDIYGIPKTKKWRSFFEE 108 >2h3o_A MERF; membrane protein, alpha-helix, bicelle; NMR {Morganella morganii} (A:) Length = 61 Score = 24.7 bits (54), Expect = 5.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 125 LVIALCCATDVLIHHYGIV 143 ++AL T VL+ G+V Sbjct: 5 TLVALSSFTPVLVILLGVV 23 >1dmu_A BGLI restriction endonuclease; protein-DNA complex, active site calcium IONS, alpha/beta structure; HET: DNA; 2.20A {Bacillus subtilis} (A:) Length = 299 Score = 24.2 bits (52), Expect = 9.0 Identities = 8/28 (28%), Positives = 18/28 (64%) Query: 72 GGIKSSQMRILSKKTNNLFQGTLKPAHV 99 GGI+++Q I +++ +F T+ P ++ Sbjct: 173 GGIQNNQQTIQGPRSSQIFLPTIPPLYI 200 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0753 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,210,022 Number of extensions: 50965 Number of successful extensions: 121 Number of sequences better than 10.0: 1 Number of HSP's gapped: 121 Number of HSP's successfully gapped: 20 Length of query: 155 Length of database: 4,956,049 Length adjustment: 81 Effective length of query: 74 Effective length of database: 2,217,844 Effective search space: 164120456 Effective search space used: 164120456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.4 bits)