RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] (155 letters) >d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Score = 27.3 bits (60), Expect = 0.56 Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 11 IPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVR 53 + D++I + C ++++ EK +I +E N+ VR Sbjct: 2 TKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVR 44 >d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Length = 159 Score = 25.6 bits (56), Expect = 1.8 Identities = 12/39 (30%), Positives = 19/39 (48%) Query: 37 EKFNKIFIQEGNIYNVRVEKEIIKASEERQENGRKGGIK 75 + K FI +G+ +V + I + E + NG G IK Sbjct: 16 ARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIK 54 >d2b97a1 b.138.1.1 (A:1-70) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]} Length = 70 Score = 24.7 bits (54), Expect = 3.5 Identities = 7/9 (77%), Positives = 8/9 (88%) Query: 128 ALCCATDVL 136 LCCAT+VL Sbjct: 11 PLCCATNVL 19 >d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia coli [TaxId: 562]} Length = 880 Score = 24.3 bits (52), Expect = 5.1 Identities = 12/104 (11%), Positives = 37/104 (35%), Gaps = 7/104 (6%) Query: 59 IKASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPE-------SINNYSA 111 ++ +E+ + K G+ + LS T + + L P ++ S+ + Sbjct: 605 LRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDELSVISCDV 664 Query: 112 PVDFEKINPNPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN 155 + + N + + + ++ G ++R+ + + Sbjct: 665 YRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVES 708 >d1dmua_ c.52.1.4 (A:) Restriction endonuclease BglI {Bacillus subtilis [TaxId: 1423]} Length = 299 Score = 24.2 bits (52), Expect = 5.7 Identities = 8/29 (27%), Positives = 19/29 (65%) Query: 71 KGGIKSSQMRILSKKTNNLFQGTLKPAHV 99 +GGI+++Q I +++ +F T+ P ++ Sbjct: 172 EGGIQNNQQTIQGPRSSQIFLPTIPPLYI 200 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0556 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 602,327 Number of extensions: 27361 Number of successful extensions: 60 Number of sequences better than 10.0: 1 Number of HSP's gapped: 60 Number of HSP's successfully gapped: 15 Length of query: 155 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 77 Effective length of database: 1,336,656 Effective search space: 102922512 Effective search space used: 102922512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.0 bits)