BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] (155 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 319 bits (818), Expect = 1e-89, Method: Compositional matrix adjust. Identities = 155/155 (100%), Positives = 155/155 (100%) Query: 1 MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIK 60 MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIK Sbjct: 1 MISLYDRGGSIPDNDKYIAGVCGCSIRRWRNIRAILEKFNKIFIQEGNIYNVRVEKEIIK 60 Query: 61 ASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINP 120 ASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINP Sbjct: 61 ASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQKPESINNYSAPVDFEKINP 120 Query: 121 NPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN 155 NPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN Sbjct: 121 NPLNLVIALCCATDVLIHHYGIVTSRRKNDTIISN 155 >gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 898 Score = 22.7 bits (47), Expect = 3.3, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 19/29 (65%) Query: 36 LEKFNKIFIQEGNIYNVRVEKEIIKASEE 64 LE+ + ++ N Y++ + K +I+ASE+ Sbjct: 230 LERMATVLQEKTNNYDIDLFKHLIQASEQ 258 >gi|254780712|ref|YP_003065125.1| 30S ribosomal protein S16 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 22.3 bits (46), Expect = 3.8, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 123 LNLVIALCCATDVLIHHYGIVTS 145 + L I L C HHY IV + Sbjct: 1 MTLKIRLACGGSKSRHHYRIVVA 23 >gi|254780144|ref|YP_003064557.1| 50S ribosomal protein L12P [Candidatus Liberibacter asiaticus str. psy62] Length = 126 Score = 22.3 bits (46), Expect = 4.5, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 31 NIRAILEKFNKIFIQEGNIYNVRVEKE 57 NI +I+EK + + + E + R+EKE Sbjct: 3 NIESIVEKLSSLTLIEAAELSKRLEKE 29 >gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] Length = 167 Score = 21.9 bits (45), Expect = 4.7, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 107 NNYSAPVDFEKINPNPLNL 125 +NYS PV + + P+NL Sbjct: 5 SNYSYPVSVQAVFSTPMNL 23 >gi|254780635|ref|YP_003065048.1| hypothetical protein CLIBASIA_02610 [Candidatus Liberibacter asiaticus str. psy62] Length = 412 Score = 21.9 bits (45), Expect = 6.0, Method: Compositional matrix adjust. Identities = 13/54 (24%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 57 EIIKASEERQENGRKGGIKSSQMRILSKKTNNLFQGTLKPAHVFQ-KPESINNY 109 E I+ + E+ + S R L+++ N+ F T+K H+ + + E+I ++ Sbjct: 310 EYIRMNGEKIHGASIHDLISHNNRNLAQEINDKFSNTMKDFHILKDRAENIESF 363 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.137 0.403 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 105,034 Number of Sequences: 1233 Number of extensions: 4202 Number of successful extensions: 16 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 12 length of query: 155 length of database: 328,796 effective HSP length: 67 effective length of query: 88 effective length of database: 246,185 effective search space: 21664280 effective search space used: 21664280 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 35 (18.1 bits)